DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and TRE2

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 / 854430 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:451 Identity:89/451 - (19%)
Similarity:157/451 - (34%) Gaps:100/451 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YLSLVNTQMNHMPRPLTRSDEASHPNSFIAQR-------AEDTLIELTRIGPRVVGSMANEESAV 92
            |..:..|...|.....|.|  :|| |..::||       :.|..|| |.|.|      ..|..:.
Yeast     5 YQPVSTTNFEHENAIPTAS--SSH-NLLMSQRFDDSPPSSNDNSIE-TNITP------PPEPPSY 59

  Fly    93 EFLRAEVAKVESEMSDLLEIEVDVQQASGAYMHWEMVNMYQGIQNVVVKLSEKNSTNENYLLINS 157
            ||      .:|....||.: ...:|:.|..:....:..:.:.|.:.::::|:......:|     
Yeast    60 EF------DIEDPHDDLHK-RTHLQRVSIGFQEKILEPLMENIIHPLLQISKFVPDKADY----- 112

  Fly   158 HYDSVPGSPGAGDDGSMVVTMLEVMRVIAKSGDPLAHPIVFLFNGAEENPLQASHAFITQH---- 218
             |.|..|:|........::.|..:...:..||        :|||    .....|....:||    
Yeast   113 -YLSKIGNPFILRRFFYIIFMSFIAYYVLSSG--------YLFN----EKASGSKGMFSQHDILF 164

  Fly   219 KWAKNCKALINLDSAGSGGREILFQSGPNH----PWLMNYYRNVPHPFANTLAEELFQAGYIPSD 279
            ::||....|...:      |::.:.|...|    ......||.:...|.|...:.:.:.||    
Yeast   165 EYAKKSVDLAKFE------RDLEYISSMPHGSGTKGDAAIYRYIQESFDNNGLKLVKEMGY---- 219

  Fly   280 TDFRIFRDYGGVPGLDMAYIFNGYVYH------TKYNRINA---FPRASFQHTGDNVLSLARALA 335
               .::.:|.|  .:.::|..|....|      ..:|.:::   ..:.|..:.|.......:.|.
Yeast   220 ---SVYSNYPG--NVSISYYDNKNEKHDLELSKENFNPLSSNGKLSKVSLIYGGKGTTYDLQHLK 279

  Fly   336 NAPELDDTAAH----------SEGHNIFYDFLGWFMIFYTETTSIIVNVVVTLLALLGVGISIYF 390
            ::..::|...:          |:...|...|....:||.:|.....::||.:    ..||:..|.
Yeast   280 DSKTIEDGKDYVLLLQYDKLVSQQVLIAEKFGAKAVIFISEPYGENIDVVQS----KPVGLPQYS 340

  Fly   391 MSLRSGCSWKGVLL-----RFSISIAIQFVSLILAIGLALLVALFMDGV-------DRSMS 439
            ....||.:|.|..:     :|.....|..:.:....|..||..|...||       |||.|
Yeast   341 TGDASGLNWDGSPVEEKDHKFWRQTHIPTIPISTRQGKELLSRLSSGGVTVDDGNSDRSNS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 59/338 (17%)
TRE2NP_014899.1 PA 249..392 CDD:238300 28/146 (19%)
M28_PMSA_TfR_like 417..643 CDD:349871
TFR_dimer 668..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.