DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and VPS70

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:78/362 - (21%)
Similarity:126/362 - (34%) Gaps:115/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RIGP----RVVGSMANEESAVE--FLRAEVAKVESEMSDLLEIEVDVQQASGAYMHWEMVNMYQG 134
            :|||    :..||.....|:::  .|..|:.....|||   .:||.:                .|
Yeast   388 QIGPGSNIKDFGSFTGPSSSIDKVHLHNELTYNIKEMS---SVEVSI----------------PG 433

  Fly   135 IQNVVVKLSEKNSTNENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMRVIAK----SGDPLAHP 195
            |            ..|..::|.:|.||: .|..|||..|....:||:.|.::|    ...|| .|
Yeast   434 I------------FTEGEIIIGAHRDSL-ASSSAGDANSGSAILLEIARGMSKLLKHGWKPL-RP 484

  Fly   196 IVFLFNGAEENPLQASHAFITQHKWAKNCKALI--NLDSAGSGGREILFQSGPNHPWLMNYYRNV 258
            |..:....|.:.|..|..:...|......:||:  |||:|.||               .|:    
Yeast   485 IKLISWDGERSGLLGSTDYAEAHAAILRRRALVYLNLDNAISG---------------TNF---- 530

  Fly   259 PHPFANTLAEE-LFQAGYIPSDTDFRIFRDY-----------GGVPGLDMAYIFNGYVYHTKYNR 311
             |..||.|.:: :::|..:   |:|....|:           ..:..||....:..:.||.    
Yeast   531 -HCKANPLLQDVIYEAAKL---TEFNGHEDWSLFDHWKYTSNATISLLDGLSSYTSFQYHL---- 587

  Fly   312 INAFPRASFQHTGDNVLSLARALANAPELDDTAAHSEGHNIFYDFLGWFMIFYTETTSIIVNVVV 376
              ..|.|.||.             ||.:......||   |..:|...|...| |.:...:.|.:.
Yeast   588 --GVPAAHFQF-------------NANDTSGAVYHS---NSVFDSPTWLEKF-TNSDYKLHNTMA 633

  Fly   377 TLLALLGVGISIYFMSLRSGCSWKGVLLRFSISIAIQ 413
                 :.||::...:|       :..|.||:..:.::
Yeast   634 -----MFVGLTTLMLS-------ENELARFNTHVYLK 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 69/311 (22%)
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036 6/24 (25%)
M28_PMSA_TfR_like 419..649 CDD:349871 67/320 (21%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.