DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and Naaladl1

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 / 83568 RGDID:620987 Length:745 Species:Rattus norvegicus


Alignment Length:294 Identity:67/294 - (22%)
Similarity:105/294 - (35%) Gaps:91/294 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 NVVVKLSEKNSTN-----------ENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMRVIA---K 187
            :|..:|..:||:|           :.|::..:|.||  ...||.|..|....:||:.||:.   |
  Rat   341 SVYNRLELRNSSNVLGIIQGAVEPDRYVIYGNHRDS--WVHGAVDPSSGTAVLLEISRVLGTLLK 403

  Fly   188 SGD--PLAHPIVFLFNGAEENPLQASHAFITQ--HKWAKNCKALINLD-SAGSGG---------- 237
            .|.  | ...|:|...||||..|..|..|..:  .|..:.....||:| |..|..          
  Rat   404 KGTWRP-RRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVTYINVDISVFSNATLRAQGTPPV 467

  Fly   238 REILFQ-----SGPNHPWLMNY-----YRNVPHPFANTLAEELFQAGYIPS------DTDFRIFR 286
            :.::|.     |.|....|..|     |.|...|.          .|.:||      .:|:..|.
  Rat   468 QSVIFSATKEISAPGSSGLSIYDNWIRYTNRSSPV----------YGLVPSMGTLGAGSDYASFI 522

  Fly   287 DYGGVPGLDMAYIFNGY--------VYHTKYNRIN----------AFPRASFQHTGDNVLSLARA 333
            .:.|:..:|:||.::..        .|||.::..:          :..:|..:..|..:|.|:.:
  Rat   523 HFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRLSDS 587

  Fly   334 L---ANAPELDDT------------AAHSEGHNI 352
            |   .|..:..:|            .|..|.|||
  Rat   588 LFLPLNVSDYSETLQSFLQAAQENLGALLESHNI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 67/294 (23%)
Naaladl1NP_113947.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 119..331 CDD:239036
M28_PSMA_like <353..592 CDD:349942 56/251 (22%)
TFR_dimer 621..740 CDD:367885 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.