DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and naalad2

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_956571.1 Gene:naalad2 / 393247 ZFINID:ZDB-GENE-040426-1025 Length:745 Species:Danio rerio


Alignment Length:229 Identity:46/229 - (20%)
Similarity:80/229 - (34%) Gaps:57/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ENYLLINSHYDS-VPGSPGAGDDGSMVVTMLEVMRVIAKSGDPLAHPIVFLFNGAEENPLQASHA 213
            :.|:::..|.|: |.|........::|...:.....:.|.|......::|....|||..||.|  
Zfish   356 DRYIILGGHRDAWVFGGIDPVSGAAVVHENVRAAGKLMKKGWRPRRTLIFASWDAEEFGLQGS-- 418

  Fly   214 FITQHKWAK-NCKAL-------INLDSAGSGGREILFQSGPN-HPWLMNYYRNVPHPFANTLAEE 269
                .:||: |.:.|       ||.|||..|...:.....|: |..:.:..:.|..|........
Zfish   419 ----TEWAEDNARVLQERAVAYINADSAIEGMYTLRVDCTPSLHTLVYDITKKVLSPEEGEEGMS 479

  Fly   270 LFQAGY---------------IPSDTDFRIFRDYGGVPGLDMAYI-------FNGY-VYHT---- 307
            |:::.:               :.|.:||..:....|:......|.       ::.| |||:    
Zfish   480 LYESWHKRDNWPEKDKPWISKLGSGSDFEAYFIRLGITSGRARYTKNRKTERYSSYPVYHSVYET 544

  Fly   308 ----------KYNRINAFPRASFQHTGDNVLSLA 331
                      ::.|:.|..|.    .|..:.|||
Zfish   545 YEIVERFYDPRFRRLEAVARV----RGGLIFSLA 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 46/229 (20%)
naalad2NP_956571.1 Zinc_peptidase_like 47..>102 CDD:301362
PA_GCPII_like 108..333 CDD:239036
M28_PSMA_like 341..581 CDD:193568 46/229 (20%)
TFR_dimer 618..733 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.