DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and Tfr2

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_006249178.1 Gene:Tfr2 / 288562 RGDID:1310152 Length:838 Species:Rattus norvegicus


Alignment Length:195 Identity:41/195 - (21%)
Similarity:82/195 - (42%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMRV---IAKSGDPLAHPIVFL-FNGAEENPLQA 210
            ::|::|.:..|:  ..|||.........:||::|.   :..||......::|: ::|.:...:.|
  Rat   459 DHYVVIGAQRDA--WGPGAAKSAVGTAILLELVRTFSSMVSSGFRPRRSLLFISWDGGDFGSVGA 521

  Fly   211 SHAFITQHKWAK------NCKAL--INLDSAGSGGREILFQSGPNH----PWLMNYYRNV----- 258
            :       :|.:      :.||:  ::||::..|       .|..|    |.|::...|:     
  Rat   522 T-------EWLEGYLSVLHLKAVVYVSLDNSVLG-------DGKFHAKTSPLLVSLIENILKQVD 572

  Fly   259 -PHPFANTLAE-----------ELFQAGYIPSDTDFRIFRDYGGVPGLDMAYIFNGYVY---HTK 308
             |:....||.:           |:.|.  :|.|:....|..:.|||.::.:::.:..||   |||
  Rat   573 SPNHSGQTLYDQVAFTHPSWDAEVIQP--LPMDSSAYSFTAFAGVPAVEFSFMEDDRVYPFLHTK 635

  Fly   309  308
              Rat   636  635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 41/195 (21%)
Tfr2XP_006249178.1 PA_TfR 246..436 CDD:239043
M28_TfR 444..677 CDD:193572 41/195 (21%)
TFR_dimer 709..828 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.