DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and NAALADL2

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:306 Identity:64/306 - (20%)
Similarity:109/306 - (35%) Gaps:65/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AFFGFWLVLYL------SLVNTQMNHMPRPLTRSDEASHP------NSFIAQRAEDTLIELTRIG 78
            |.|| .::||:      ..||...:.....|....:.|.|      .||...|:..|.:.:..|.
Human   330 AGFG-GVLLYIDPCDLPKTVNPSHDTFMVSLNPGGDPSTPGYPSVDESFRQSRSNLTSLLVQPIS 393

  Fly    79 PRVVGSMANEESAVEFLRAEVAKVESEMSDLLEI---EVDVQQASGAYMHWEMVNMYQGIQNVVV 140
            ..:|..:         :.:..|:.::|....||:   |:.|     ..|..:.|...:.:.|||.
Human   394 APLVAKL---------ISSPKARTKNEACSSLELPNNEIRV-----VSMQVQTVTKLKTVTNVVG 444

  Fly   141 KLSEKNSTNENYLLINSHYDSVPGSPGA--GDDGSMVVTMLEVMRVIAKSGDPLAHPIVFLFNGA 203
            .:....|. :.|:::.||:.:.....|.  ....:::...:..:....|.|......|||...|.
Human   445 FVMGLTSP-DRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMSKVKRGWRPDRTIVFCSWGG 508

  Fly   204 EENPLQASHAF--ITQHKWA--------KNCKALINLDSAGSGGREILFQSGPNHPWLM------ 252
            .        ||  |..::|.        ||..|.|:|.|...|...:...:.|:...|:      
Human   509 T--------AFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLYPVASPSLQQLVVEKNNF 565

  Fly   253 NYYRNVPHPFANTLAEELFQAGYIPSDTDFRIFRDYGGVPGLDMAY 298
            |..|....|..|..:.:      |..|.|:  |.::.|||.:..||
Human   566 NCTRRAQCPETNISSIQ------IQGDADY--FINHLGVPIVQFAY 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 55/267 (21%)
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169 20/99 (20%)
Zinc_peptidase_like 437..659 CDD:301362 40/184 (22%)
TFR_dimer 686..>744 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.