DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and FOLH1

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_016872921.1 Gene:FOLH1 / 2346 HGNCID:3788 Length:805 Species:Homo sapiens


Alignment Length:405 Identity:80/405 - (19%)
Similarity:133/405 - (32%) Gaps:118/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MHWEMVNMYQGIQNVVVKLSEKNSTN-ENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMR---V 184
            ||....|....|.||:..|  :.:.. :.|:::..|.||  ...|..|..|....:.|::|   .
Human   399 MHIHSTNEVTRIYNVIGTL--RGAVEPDRYVILGGHRDS--WVFGGIDPQSGAAVVHEIVRSFGT 459

  Fly   185 IAKSGDPLAHPIVFLFNGAEENPLQASHAFITQHKWA-KNCK-------ALINLDSAGSGGREIL 241
            :.|.|......|:|....|||..|..|      .:|| :|.:       |.||.||:..|...:.
Human   460 LKKEGWRPRRTILFASWDAEEFGLLGS------TEWAEENSRLLQERGVAYINADSSIEGNYTLR 518

  Fly   242 FQSGP-NHPWLMNYYRNVPHPFANTLAEELFQA----------------GYIPSDTDFRIFRDYG 289
            ....| .:..:.|..:.:..|......:.|:::                ..:.|..||.:|....
Human   519 VDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRL 583

  Fly   290 GVPGLDMAYI-------FNGY-VYHT---KYNRINAFPRASFQH-------TGDNVLSLARALAN 336
            |:......|.       |:|| :||:   .|..:..|....|::       .|..|..||.::..
Human   584 GIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVL 648

  Fly   337 APELDDTAAHSEGHNIFYDFLGWFMIFYTETTSIIVNVVVTLLALLGVGISIYFMSLRSGCSWKG 401
            ..:..|.|                                  :.|......||.:|::.....| 
Human   649 PFDCRDYA----------------------------------VVLRKYADKIYSISMKHPQEMK- 678

  Fly   402 VLLRFSISIAIQFVSLILAI-GLALLVALF---MDGVDRSMSWFTSSWTIFGLYLAPIVFGLSIL 462
                   :.::.|.||..|: ....:.:.|   :...|:|               .|||..:...
Human   679 -------TYSVSFDSLFSAVKNFTEIASKFSERLQDFDKS---------------NPIVLRMMND 721

  Fly   463 PALYLEKTKRDPLGL 477
            ..::||:...|||||
Human   722 QLMFLERAFIDPLGL 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 58/286 (20%)
FOLH1XP_016872921.1 Zinc_peptidase_like 113..>169 CDD:301362
PA_GCPII_like 175..401 CDD:239036 1/1 (100%)
M28_PSMA_like 403..650 CDD:193568 54/256 (21%)
TFR_dimer 687..802 CDD:282153 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.