DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and Tfrc

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001344227.1 Gene:Tfrc / 22042 MGIID:98822 Length:763 Species:Mus musculus


Alignment Length:273 Identity:59/273 - (21%)
Similarity:99/273 - (36%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 VTNAGFPYKEKTSPQRYSL-----------IHAHRRLHNADGSTRIDESGLYIYPQDRRFGIAKD 676
            :.:|.|..|:......||:           |....::.||.....|   |:.||....:|.:.:.
Mouse   234 LVHANFGTKKDFEELSYSVNGSLVIVRAGEITFAEKVANAQSFNAI---GVLIYMDKNKFPVVEA 295

  Fly   677 NIAAIGEAHQVSDFCDEEMFCGMPLYNHRWNKARQYSMWIETSESPEIPTEYPMLVLQDSSE--- 738
            ::|..|.||..:   .:....|.|.:||......|      :|..|.||.:   .:.:.::|   
Mouse   296 DLALFGHAHLGT---GDPYTPGFPSFNHTQFPPSQ------SSGLPNIPVQ---TISRAAAEKLF 348

  Fly   739 --LETSAQRRFN------FTLAGPSHMGIFI-NVKNDARILNWSFNDTLIREQAEPPYMVYFSYG 794
              :|.|...|:|      ..|:...::.:.: ||..:.|||| .|.  :|:...||..  |...|
Mouse   349 GKMEGSCPARWNIDSSCKLELSQNQNVKLIVKNVLKERRILN-IFG--VIKGYEEPDR--YVVVG 408

  Fly   795 LDDSPLEFTIDVELN---DYLQKTTSTFD--------TPTLEIGIGGHWVTQDITAI---EKLSS 845
            .....|...:..:.:   ..|.|....|.        .|:..| |...|...|..|:   |.|..
Mouse   409 AQRDALGAGVAAKSSVGTGLLLKLAQVFSDMISKDGFRPSRSI-IFASWTAGDFGAVGATEWLEG 472

  Fly   846 YIN--RFPSYAYI 856
            |::  ...::.||
Mouse   473 YLSSLHLKAFTYI 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497
TfrcNP_001344227.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 203..379 CDD:239043 32/159 (20%)
Zinc_peptidase_like 387..613 CDD:326366 25/105 (24%)
Ligand-binding. /evidence=ECO:0000250 572..763
TFR_dimer 645..749 CDD:309400
Cell attachment site. /evidence=ECO:0000255 649..651
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.