DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and gcp-2.2

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_509928.3 Gene:gcp-2.2 / 183230 WormBaseID:WBGene00007954 Length:779 Species:Caenorhabditis elegans


Alignment Length:225 Identity:61/225 - (27%)
Similarity:100/225 - (44%) Gaps:52/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MHWEMVNMYQGIQNVV--VKLSEKNSTNENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMRVIA 186
            :|.|  |..:.|||::  :|.|::   .:.::|:::|||:  .:.||.|..|...|:|||.|.:.
 Worm   364 VHAE--NEERKIQNIMGYIKGSQE---PDKFVLVSNHYDA--WTYGAVDPNSGTSTLLEVSRALK 421

  Fly   187 ----KSGDPLAHPIVFLFNGAEENPLQASHAFITQHK--WAKNCKALINLDSAGSGGREILFQSG 245
                ::|...|..|:|....|||..|..|..|..:::  ..:...|:||:|..| |.:.:|   |
 Worm   422 QYQNQTGWIPARSILFAHWDAEEYGLIGSTEFAEEYRLQLMRRAVAVINMDLIG-GNQTLL---G 482

  Fly   246 PNHPWLMNYYR----NVPHPFANTLAE---ELFQAG--YIPS---------------DTDFRIFR 286
            .::|.:.|..|    ||..|....:.:   .|:.:.  |.||               .:|...|.
 Worm   483 LSNPTVANVLRSAAANVEQPNPTEMEQGRKTLYDSWKYYAPSKNNRSTHPYQRIPAGGSDHLPFF 547

  Fly   287 DYGGVP-------GLDMAYIFNGYVYHTKY 309
            ||.|:|       .||....:.  :|||.|
 Worm   548 DYLGIPIVFFITSSLDAPPTYP--LYHTIY 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 61/225 (27%)
gcp-2.2NP_509928.3 Zinc_peptidase_like 75..>133 CDD:301362
PA_GCPII_like 137..364 CDD:239036 61/225 (27%)
M28_PSMA_like 372..614 CDD:193568 58/215 (27%)
TFR_dimer 652..773 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.