DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and CPQ

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_057218.1 Gene:CPQ / 10404 HGNCID:16910 Length:472 Species:Homo sapiens


Alignment Length:310 Identity:65/310 - (20%)
Similarity:111/310 - (35%) Gaps:68/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVNTQMNHMPRPLTRSDEA-------SHP---NSFIAQRAEDTLIELTRIGP-----RVVGSMA- 86
            ||.|..:.:.|   |:.||       :.|   .|...|......:|..::|.     |.|.|.: 
Human   151 LVVTSFDELQR---RASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSI 212

  Fly    87 -NEESAVEFLRAEVAKVESEMSDLLEIEVDVQQASGAYMHWEMVNMYQGIQNVV-VKLSEK---- 145
             :..:.::..:..|.|:.:....:.:.|:..:.||            .||:.|: :|:..|    
Human   213 YSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMAS------------HGIKIVIQLKMGAKTYPD 265

  Fly   146 -NSTN-----------ENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMRVIAKSGDPLAHPIVF 198
             :|.|           |..:|::.|.||.....||.|||.......|.:.:|...|......:..
Human   266 TDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRL 330

  Fly   199 LFNGAEENPLQASHAFITQHKWAKNCKALINLDSAG----SGGREILFQSGPNHPWLMNYYRNVP 259
            :...|||.....:..:...||...:..:|:....||    :|   :.|........:|....::.
Human   331 VLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTG---LQFTGSEKARAIMEEVMSLL 392

  Fly   260 HPFANTLAEELFQAGYIPSDTDFRIFRDYGGVPG---LDMAYIFNGYVYH 306
            .|...|   ::...|   ..||.. |....||||   ||..|.:  :.:|
Human   393 QPLNIT---QVLSHG---EGTDIN-FWIQAGVPGASLLDDLYKY--FFFH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 58/282 (21%)
CPQNP_057218.1 M28_Pgcp_like 47..449 CDD:193504 65/310 (21%)
PA_M28_2 130..256 CDD:240119 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.