DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and NAALADL1

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_005459.2 Gene:NAALADL1 / 10004 HGNCID:23536 Length:740 Species:Homo sapiens


Alignment Length:379 Identity:79/379 - (20%)
Similarity:117/379 - (30%) Gaps:155/379 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WYYAPA---------FFGFWLVLYLSLVNTQMNHMPRPLTRSDEA---------SHPNSFIAQRA 67
            ||..|:         :||..|..||..|.:..        |.|.|         :.|..|  |.|
Human   237 WYLPPSGVERGSYYEYFGDPLTPYLPAVPSSF--------RVDLANVSGFPPIPTQPIGF--QDA 291

  Fly    68 EDTLIELT----------------RIGPRVVGSMANEESAVEFLRAEVAKVESEMSDLLEIEVDV 116
            .|.|..|.                |:||..                                   
Human   292 RDLLCNLNGTLAPATWQGALGCHYRLGPGF----------------------------------- 321

  Fly   117 QQASGAYMHWEMVNMYQGIQNVVVKLSEKNSTN-----------ENYLLINSHYDSVPGSPGAGD 170
             :..|.:.....||:     :|..:|..:||:|           :.|:|..:|.||  ...||.|
Human   322 -RPDGDFPADSQVNV-----SVYNRLELRNSSNVLGIIRGAVEPDRYVLYGNHRDS--WVHGAVD 378

  Fly   171 DGSMVVTMLEVMRVIA---KSGD--PLAHPIVFLFNGAEENPLQASHAFITQ--HKWAKNCKALI 228
            ..|....:||:.||:.   |.|.  | ...|||...||||..|..|..|..:  :|..:...|.|
Human   379 PSSGTAVLLELSRVLGTLLKKGTWRP-RRSIVFASWGAEEFGLIGSTEFTEEFFNKLQERTVAYI 442

  Fly   229 NLDSAGSGGREILFQSGP-------------NHP----------WLMNYYRNVPHPFANTLAEEL 270
            |:|.:......:..|..|             ..|          |:..:.|:.|           
Human   443 NVDISVFANATLRVQGTPPVQSVVFSATKEIRSPGPGDLSIYDNWIRYFNRSSP----------- 496

  Fly   271 FQAGYIPS------DTDFRIFRDYGGVPGLDMAYIFNGY--------VYHTKYN 310
             ..|.:||      .:|:..|..:.|:..:|:||.::..        .|||.::
Human   497 -VYGLVPSLGSLGAGSDYAPFVHFLGISSMDIAYTYDRSKTSARIYPTYHTAFD 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 67/323 (21%)
NAALADL1NP_005459.2 Zinc_peptidase_like 46..>121 CDD:387401
PA_GCPII_like 109..335 CDD:239036 24/143 (17%)
M28_PSMA_like <348..587 CDD:349942 50/217 (23%)
TFR_dimer 616..735 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.