DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and NAALAD2

DIOPT Version :9

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_016872532.1 Gene:NAALAD2 / 10003 HGNCID:14526 Length:775 Species:Homo sapiens


Alignment Length:224 Identity:53/224 - (23%)
Similarity:85/224 - (37%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MHWEMVNMYQGIQNVVVKLSEKNSTN-ENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMR---- 183
            ||...:|....|.|||..:  :.|.. :.|:::..|.||  ...||.|..|.|..:.|:.|    
Human   369 MHVYNINKITRIYNVVGTI--RGSVEPDRYVILGGHRDS--WVFGAIDPTSGVAVLQEIARSFGK 429

  Fly   184 VIAKSGDPLAHPIVFLFNGAEENPLQASHAFITQHKWA-KNCK-------ALINLDSAGSGGREI 240
            :::|...| ...|:|....|||..|..|      .:|| :|.|       |.||.||:..|...:
Human   430 LMSKGWRP-RRTIIFASWDAEEFGLLGS------TEWAEENVKILQERSIAYINSDSSIEGNYTL 487

  Fly   241 LFQSGP-NHPWLMNYYRNVPHPFANTLAEELFQA----------------GYIPSDTDFRIFRDY 288
            .....| .:..:....:.:|.|.....::.|:::                ..:.|.:||..:...
Human   488 RVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQR 552

  Fly   289 GGVPGLDMAYI-------FNGY-VYHTKY 309
            .|:......|.       ::.| ||||.|
Human   553 LGIASGRARYTKNKKTDKYSSYPVYHTIY 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 53/224 (24%)
NAALAD2XP_016872532.1 Zinc_peptidase_like 93..>139 CDD:301362
PA_GCPII_like 145..371 CDD:239036 1/1 (100%)
M28_PSMA_like 373..620 CDD:193568 51/220 (23%)
TFR_dimer 657..772 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.