DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and yfbL

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_416774.2 Gene:yfbL / 945832 ECOCYCID:G7178 Length:323 Species:Escherichia coli


Alignment Length:366 Identity:74/366 - (20%)
Similarity:137/366 - (37%) Gaps:107/366 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FLLFYLVVIPS--FHRMPQLKTLEDERQQPGQFIGERAENTLLRLSK-IGPKVVGSAANEQVAVQ 91
            |::.::.::|.  |:: |.:..|.   ..|.....|:.|.|:..|:: :.|:...:..|...:.:
E. coli     8 FIILFVFLLPMIIFYQ-PWVNALP---STPRHASPEQLEKTVRYLTQTVHPRSADNIDNLNRSAE 68

  Fly    92 FLLSEIGDIIDDARTDLYDIEKDVQVASGNYLLWSMVNVYQSIQNVVVKLSPKNATSEAALLINS 156
            ::....  :...||.    ..:||.:..|.|            :|:|....|.:.   ..::|.:
E. coli    69 YIKEVF--VSSGARV----TSQDVPITGGPY------------KNIVADYGPADG---PLIIIGA 112

  Fly   157 HFDS-----------VPGS--SGAGDAGMMCVIMLEVLRVITKYETPLTYSVVFLFNGAEENPL- 207
            |:||           .||:  :.:|.||     :||:.|::.: :.|.| .|..:...:||.|. 
E. coli   113 HYDSASSYENDQLTYTPGADDNASGVAG-----LLELARLLHQ-QVPKT-GVQLVAYASEEPPFF 170

  Fly   208 ----QGS--HAFITQHPWAQNIRAVINLDSAGSGGREILFQSGP---DHP-----WLMKYYGKNI 258
                .||  ||...:.|    ::.:|.|:..|      .:.|.|   ::|     ||....|   
E. coli   171 RSDEMGSAVHAASLERP----VKLMIALEMIG------YYDSAPGSQNYPYPAMSWLYPDRG--- 222

  Fly   259 VHPFASTIGEELFQNGF------VPSETDYRVF--RDYGHIPGLDMAQTLNGY------------ 303
              .|.:.:|.....|..      :.|..|..|:  ...|.|||:|.:..||.:            
E. coli   223 --DFIAVVGRIQDINAVRQVKAALLSSQDLSVYSMNTPGFIPGIDFSDHLNYWQHDIPAIMITDT 285

  Fly   304 ------VYHTKYDRFNLIPRRTYQLTGENILALVKALANAE 338
                  .||...|..:   |..||...:.:..::..|.|::
E. coli   286 AFYRNKQYHLPGDTAD---RLNYQKMAQVVDGVITLLYNSK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 69/337 (20%)
MFS 423..>624 CDD:304372
yfbLNP_416774.2 M28_like 37..322 CDD:349893 67/330 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.