DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and TRE2

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 / 854430 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:52/236 - (22%)
Similarity:87/236 - (36%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LSEIGDIIDDARTD----------LYDIEKDVQVASGNYLLWSMVNVYQSIQNVVVKLSPKNATS 148
            ||..|..:||..:|          |.|::....|...::           |.|:|.|:..:..:.
Yeast   384 LSSGGVTVDDGNSDRSNSGKMGDVLIDVDLQTNVREKHF-----------IPNIVGKIEGREQSD 437

  Fly   149 EAALLINSHFDSVPGSS--GAGDAGMMCVIML--EVLRVITKYE---TPLTYSVVFLFNGAEENP 206
            :|.::..|......|::  ..|.|.::.::.|  ||     ||:   .||.......|.|.|.| 
Yeast   438 KAIIIAASRNSINFGTTYPNFGTAALLSIVQLFQEV-----KYKFGWKPLRNIYFISFGGTEFN- 496

  Fly   207 LQGSHAFITQH--PWAQNIRAVINLDSAGSGGREILFQSG--------PDHPWLMKYYGK----- 256
            ..||...:.|.  |....|.::|::...|....| .:::|        ..||.|.|::.:     
Yeast   497 YAGSSELVEQRLTPLKDEIYSLIDISQLGIPFAE-KYENGKTRGELSIETHPLLKKFFNRNAHGN 560

  Fly   257 ------NIVH-----PF------ASTIGEELFQNGFVPSET 280
                  |:.|     ||      .|.|..:..:|...|:||
Yeast   561 FDISVDNVQHYGDWTPFLANGIPVSVISSDSTRNRDTPTET 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 52/236 (22%)
MFS 423..>624 CDD:304372
TRE2NP_014899.1 PA 249..392 CDD:238300 3/7 (43%)
M28_PMSA_TfR_like 417..643 CDD:349871 44/203 (22%)
TFR_dimer 668..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.