DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and VPS70

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:60/263 - (22%)
Similarity:105/263 - (39%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VKLSPKNATSEAALLINSHFDSVPGSSGAGDAGMMCVIMLEVLRVITKY----ETPLTYSVVFLF 199
            |::|.....:|..::|.:|.||: .||.||||.....|:||:.|.::|.    ..||....:..:
Yeast   427 VEVSIPGIFTEGEIIIGAHRDSL-ASSSAGDANSGSAILLEIARGMSKLLKHGWKPLRPIKLISW 490

  Fly   200 NGAEENPLQGSHAFITQHPWAQNIRAVI--NLDSAGSGG----------REILFQSGP------- 245
            :| |.:.|.||..:...|......||::  |||:|.||.          :::::::..       
Yeast   491 DG-ERSGLLGSTDYAEAHAAILRRRALVYLNLDNAISGTNFHCKANPLLQDVIYEAAKLTEFNGH 554

  Fly   246 ------DHPWLMKYYGKNIVHPFASTIGEELFQNGFVPSETDYRVFRDYGHIPGLDM---AQTLN 301
                  || |  ||...       :||       ..:...:.|..|:.:..:|....   |...:
Yeast   555 EDWSLFDH-W--KYTSN-------ATI-------SLLDGLSSYTSFQYHLGVPAAHFQFNANDTS 602

  Fly   302 GYVYHTK--YDRFNLIPRRT---YQLTGENILALVKALANAEELENPSKYAEGHMIFFDMMGWFF 361
            |.|||:.  :|....:.:.|   |:|  .|.:|:...|......||.......|:....:..|:.
Yeast   603 GAVYHSNSVFDSPTWLEKFTNSDYKL--HNTMAMFVGLTTLMLSENELARFNTHVYLKKIYNWYI 665

  Fly   362 VYY 364
            .::
Yeast   666 AWH 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 60/261 (23%)
MFS 423..>624 CDD:304372
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036
M28_PMSA_TfR_like 419..649 CDD:349871 58/242 (24%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.