DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and Naaladl1

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 / 83568 RGDID:620987 Length:745 Species:Rattus norvegicus


Alignment Length:349 Identity:81/349 - (23%)
Similarity:127/349 - (36%) Gaps:93/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGQFIG-ERAENTLLRLS----------------KIGPKVVGSAANEQVAVQFLLSEIGDIIDDA 104
            |.|.|| |.|:|.|..|:                |:||   |...|..                 
  Rat   287 PTQPIGFEDAKNLLCNLNGTSAPDSWQGALGCEYKLGP---GFEPNGN----------------- 331

  Fly   105 RTDLYDIEKDVQVASGNYL-LWSMVNVYQSIQNVVVKLSPKNATSEAALLINSHFDSVPGSSGAG 168
                :....:|:|:..|.| |.:..||...||..|        ..:..::..:|.||  ...||.
  Rat   332 ----FPAGSEVKVSVYNRLELRNSSNVLGIIQGAV--------EPDRYVIYGNHRDS--WVHGAV 382

  Fly   169 DAGMMCVIMLEVLRVITKYETPLTY----SVVFLFNGAEENPLQGSHAFITQHPWAQNIRAV--I 227
            |......::||:.||:.......|:    |::|...||||..|.||..|..:.......|.|  |
  Rat   383 DPSSGTAVLLEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVTYI 447

  Fly   228 NLDSAGSGGREILFQSGPDHPWLMKYYGKNIVHPFASTIGEELFQN------------GFVPS-- 278
            |:|.:......:..|..|....::....|.|..|.:|  |..::.|            |.|||  
  Rat   448 NVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSS--GLSIYDNWIRYTNRSSPVYGLVPSMG 510

  Fly   279 ----ETDYRVFRDYGHIPGLDMAQTLNGY--------VYHTKYDRFNLIPR------RTYQLTGE 325
                .:||..|..:..|..:|:|.|.:..        .|||.:|.|:.:.:      .::|....
  Rat   511 TLGAGSDYASFIHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVAR 575

  Fly   326 NILALVKALANAEELE-NPSKYAE 348
            ...:::..|:::..|. |.|.|:|
  Rat   576 TAGSVLLRLSDSLFLPLNVSDYSE 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 81/349 (23%)
MFS 423..>624 CDD:304372
Naaladl1NP_113947.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 119..331 CDD:239036 14/46 (30%)
M28_PSMA_like <353..592 CDD:349942 58/250 (23%)
TFR_dimer 621..740 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.