DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and AT5G19740

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_197475.2 Gene:AT5G19740 / 832094 AraportID:AT5G19740 Length:681 Species:Arabidopsis thaliana


Alignment Length:313 Identity:79/313 - (25%)
Similarity:137/313 - (43%) Gaps:50/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ERAENTLLRLS---KIGPKVVGSAANEQVAVQFLLSEIGDIIDDARTDLYDIEKDVQVASGNYLL 124
            ||..:..:.||   .:.|.:..|||:.:|   .|.:.:||:.|.   |:|.:.....|.:.:|: 
plant   246 ERLSDEAVELSGDVPLIPSLPVSAADAEV---ILKTVVGDVSDG---DVYPVGPGPGVLNLSYI- 303

  Fly   125 WSMVNVYQSIQNVVVKLSPKNATSEAALLINSHFDSVPGSSGAGDAGMMCVIMLEVLRVITKYE- 188
              ...|...|:||:..:..:.......:|.| |.|:  .:.||.|......:::|:.:.:.|.: 
plant   304 --GETVIAKIENVIGVIEGEEEPDRYVILGN-HRDA--WTFGAVDPNSGTAVLMEIAQRLDKLQK 363

  Fly   189 ---TPLTYSVVFLFN-GAEENPLQGSHAFITQHPWAQNIRAV--INLDSAGSGGREILFQSG--P 245
               .|  ...:.|.| .|||..|.||..::.::....:.|||  :|:|.|.||..   |.:.  |
plant   364 RGWKP--RRTIILCNWDAEEYGLIGSTEWVEENREMLSSRAVAYLNVDCAVSGPG---FHASATP 423

  Fly   246 DHPWLMKYYGKNIVHPFASTIGEELFQNGFVPSE-----------TDYRVFRDYGHIPGLDMAQT 299
            ....|:|...:.:..|..:|  :.::::....|:           :||..|..:..:||:||:..
plant   424 QLDELIKVAAQEVRDPDNAT--QTIYESWIGSSDSVVIRRLGGGGSDYASFVQHVGVPGVDMSFG 486

  Fly   300 LNGY-VYHTKYDRFNLI-----PRRTYQLTGENILALVKALANAEELENPSKY 346
             .|| |||:.||.|..:     |.....:...::|.|| ||..|:|...|..|
plant   487 -RGYPVYHSMYDDFTWMEKFGDPMFQRHVAMASVLGLV-ALRLADEEIIPFNY 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 79/313 (25%)
MFS 423..>624 CDD:304372
AT5G19740NP_197475.2 PA_GCPII_like 94..300 CDD:239036 16/59 (27%)
M28_PSMA_like 309..535 CDD:349942 59/237 (25%)
TFR_dimer 560..677 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.