DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and AT4G07670

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_192510.1 Gene:AT4G07670 / 826236 AraportID:AT4G07670 Length:280 Species:Arabidopsis thaliana


Alignment Length:260 Identity:46/260 - (17%)
Similarity:84/260 - (32%) Gaps:100/260 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 WSMVNVYQSIQNVVVKLS---------PKNATSEAALLINSHFDSVPGSSGAGDAGMMCVIMLEV 180
            |:.|:..:.:.:..|:||         |.:|.....:|     .::.|..|.|..      :|.:
plant   104 WASVDGCERLSDEAVELSGDVPLIPSLPVSAADAEVIL-----KTIVGDVGPGPG------ILNL 157

  Fly   181 LRVITKYETPLTYSVVFLFNGAEENPLQGSHAFITQHPWAQNIRAVINLDSAGSGGREILFQSGP 245
            ..::||.:     :|:.:..|.||   ...:..:..|......|||     ..:.|..:|.::. 
plant   158 SYIVTKIQ-----NVIGVIEGEEE---PDRYVILRNHRDTWTFRAV-----DPNSGTAVLMEAS- 208

  Fly   246 DHPWLMKYYGKNIVHPFASTIGEELFQNGFVPSETDYRVFRDYGHIPGLDMAQTLNGYVYHTKYD 310
                  |.|.::|                                      ||.|:      |..
plant   209 ------KSYLQHI--------------------------------------AQRLD------KLQ 223

  Fly   311 RFNLIPRRTYQLTGENILALVKALANAEELENPSKYAE-GHMIFFDMMGWFFVYYPETTGIIINI 374
            :....||||          ::....:|||....|..:| .:.:||     |.:.|..|:.|.:.:
plant   224 KRGWKPRRT----------IILCNWDAEEYGLVSSLSEISYWLFF-----FIIVYTNTSNISLKL 273

  Fly   375  374
            plant   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 43/248 (17%)
MFS 423..>624 CDD:304372
AT4G07670NP_192510.1 Peptidases_S8_S53 <10..150 CDD:299169 9/50 (18%)
Zinc_peptidase_like 159..>248 CDD:301362 26/162 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.