DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and Tfr2

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_030110515.1 Gene:Tfr2 / 50765 MGIID:1354956 Length:840 Species:Mus musculus


Alignment Length:351 Identity:71/351 - (20%)
Similarity:119/351 - (33%) Gaps:88/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QFIGE-RAENTLLRLSKIGPKVVGSAANEQVAVQFLLSEIG-DIIDDARTDLYDIEKDV-QVASG 120
            :|:|| |.|:| :||:.:..:|.|| |.....||.:|.::. ..:|...||.:.:.... ..|..
Mouse   183 RFLGEGRMEDT-IRLTSLRERVAGS-ARMATLVQDILDKLSRQKLDHVWTDTHYVGLQFPDPAHA 245

  Fly   121 NYLLWSMVNVYQSIQNVVVKLSPK---------NATSEAALLINSHFDSVPGSSGAGDAGMMCVI 176
            |.|.|  |:...|:|..:....|:         |||.:   |:.:|:............|:....
Mouse   246 NTLHW--VDADGSVQEQLPLEDPEVYCPYSATGNATGK---LVYAHYGRSEDLQDLKAKGVELAG 305

  Fly   177 MLEVLRV-ITKYETPLTYSVVFLFNGAEENPLQGSHAFITQHPWAQNIRAVINLDSAGSGG---- 236
            .|.::|| ||.:...:..:..|...|....|.....:.....|...:.:||......|:|.    
Mouse   306 SLLLVRVGITSFAQKVAVAQDFGAQGVLIYPDPSDFSQDPHKPGLSSHQAVYGHVHLGTGDPYTP 370

  Fly   237 -----REILF----QSG-PDHPWLMKYYGKNIVHPFASTIGEELFQ---NGFVPSETDYRVFRDY 288
                 .:..|    .|| |..|          ..|.::.|.::|.:   ....|.|..       
Mouse   371 GFPSFNQTQFPPVESSGLPSIP----------AQPISADIADQLLRKLTGPVAPQEWK------- 418

  Fly   289 GHI--------PGLDMAQTLNGYVYHTKYDRFNLIPRRTYQLTGENILALVKALANAEEL----- 340
            ||:        ||.|:...:|.:...|..               .||.|.::..|..:..     
Mouse   419 GHLSGSPYRLGPGPDLRLVVNNHRVSTPI---------------SNIFACIEGFAEPDHYVVIGA 468

  Fly   341 ------ENPSKYAEGHMIFFDMMGWF 360
                  ...:|.|.|..|..:::..|
Mouse   469 QRDAWGPGAAKSAVGTAILLELVRTF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 71/351 (20%)
MFS 423..>624 CDD:304372
Tfr2XP_030110515.1 PA_TfR 248..438 CDD:239043 40/211 (19%)
M28_TfR 446..679 CDD:349946 9/64 (14%)
TFR_dimer 706..830 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.