DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and Naaladl1

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001009546.1 Gene:Naaladl1 / 381204 MGIID:2685810 Length:745 Species:Mus musculus


Alignment Length:275 Identity:66/275 - (24%)
Similarity:109/275 - (39%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DVQVASGNYL-LWSMVNVYQSIQNVVVKLSPKNATSEAALLINSHFDSVPGSSGAGDAGMMCVIM 177
            :|:|:..|.| |.:..||...||..|        ..:..::..:|.||  ...||.|......::
Mouse   337 EVKVSVHNRLELRTSSNVLGIIQGAV--------EPDRYVIYGNHRDS--WVHGAVDPSSGTAVL 391

  Fly   178 LEVLRVITKYETPLTY----SVVFLFNGAEENPLQGSHAFITQ--HPWAQNIRAVINLDSAGSGG 236
            ||:.||:.......|:    |::|...||||..|.||..|..:  ....:...|.||:|.:....
Mouse   392 LEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVAYINVDISVFSN 456

  Fly   237 REILFQSGPDHPWLMKYYGKNIVHPFASTIGEELFQN------------GFVPS------ETDYR 283
            ..:..|..|....::....|.|..|.:|  |..::.|            |.|||      .:||.
Mouse   457 ATLRAQGTPPVQSVIFSATKEISAPGSS--GLSIYDNWIRYTNRTSPVYGLVPSLGTLGAGSDYA 519

  Fly   284 VFRDYGHIPGLDMAQTLNGY--------VYHTKYDRFNLIPR------RTYQLTGENILALVKAL 334
            .|..:..|..:|:|.|.:..        .|||.:|.|:.:.:      .::|.......:::..|
Mouse   520 AFVHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRL 584

  Fly   335 ANAEELE-NPSKYAE 348
            :::..|. |.|.|:|
Mouse   585 SDSLFLPLNVSDYSE 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 66/275 (24%)
MFS 423..>624 CDD:304372
Naaladl1NP_001009546.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 114..344 CDD:239036 2/6 (33%)
M28_PSMA_like <350..592 CDD:349942 57/253 (23%)
TFR_dimer <642..739 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.