DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and Naalad2

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001100272.1 Gene:Naalad2 / 300384 RGDID:1305872 Length:778 Species:Rattus norvegicus


Alignment Length:359 Identity:81/359 - (22%)
Similarity:110/359 - (30%) Gaps:135/359 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IGPKVVGSAANEQVAVQFLLSEIGDIIDDARTDLYDIEKDVQVASGNYLLWSMVNVYQSIQNVVV 139
            |||...||..:.:|                |..:::|.|             :..:|..|..:..
  Rat   357 IGPGFSGSEYSRKV----------------RMHVHNINK-------------ITRIYNVIGTIRG 392

  Fly   140 KLSPKNATSEAALLINSHFDSVPGSSGAGDAGMMCVIMLEVLRVITKYET----PLTYSVVFLFN 200
            ...|     :..:::..|.||  ...|..|......::.|:.|...|...    | ..:::|...
  Rat   393 STEP-----DRYVILGGHRDS--WVFGGIDPTTGTAVLQEIARSFGKLVNGGWKP-RRTIIFASW 449

  Fly   201 GAEENPLQGSHAFITQHPWA-QNIR-------AVINLDSAGSG-------------------GRE 238
            .|||..|.||    |:  || :|.:       |.||.|||..|                   .||
  Rat   450 DAEEFGLLGS----TE--WAEENAKILQERSIAYINSDSAIEGNYTLRVDCTPLLHQLVYKVARE 508

  Fly   239 ILFQSGPD---------HPWLMKYYG-KNIVHPFASTIG-----EELFQN-GFVPSETDY---RV 284
            |   |.||         ..||.|... :|...|..:.:|     |..||. |.......|   :.
  Rat   509 I---SSPDDGFESKSLYESWLEKDPSPENKERPRINKLGSGSDFEAYFQRLGIASGRARYTKNKK 570

  Fly   285 FRDYGHIPGLDMAQTLNGYVYHTKYDRFNLIPR----------RTYQLTGE-------------N 326
            ...|...|           ||||.|:.|.|:..          ...||.|.             |
  Rat   571 TDKYSSYP-----------VYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADCVVIPFN 624

  Fly   327 ILALVKALAN-AEELENPSK----YAEGHMIFFD 355
            |....|||.| |..:.|.||    ....|.:.||
  Rat   625 IQDYAKALKNYAASIFNLSKKHDQQLRDHGVSFD 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 81/359 (23%)
MFS 423..>624 CDD:304372
Naalad2NP_001100272.1 Zinc_peptidase_like 86..>143 CDD:417508
PA_GCPII_like 148..374 CDD:239036 7/32 (22%)
M28_PSMA_like <382..623 CDD:349942 59/268 (22%)
TFR_dimer 655..774 CDD:398094 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.