DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and Tfr2

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_006249178.1 Gene:Tfr2 / 288562 RGDID:1310152 Length:838 Species:Rattus norvegicus


Alignment Length:236 Identity:46/236 - (19%)
Similarity:92/236 - (38%) Gaps:63/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LLINSHFDSVPGSS--------------------------GAGDAGMMCVIMLEVLRVITKYET- 189
            |::|:|..|.|.|:                          ||..:.:...|:||::|..:...: 
  Rat   434 LVVNNHRTSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSS 498

  Fly   190 ---PLTYSVVFLFNGAEENPLQGSHAFITQHPWAQNIRAV--INLDSA--GSGG----------- 236
               |....:...::|.:...: |:..::..:....:::||  ::||::  |.|.           
  Rat   499 GFRPRRSLLFISWDGGDFGSV-GATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVS 562

  Fly   237 --REILFQ-SGPDHPWLMKYYGKNIVHPFASTIGEELFQNGFVPSETDYRVFRDYGHIPGLDMAQ 298
              ..||.| ..|:|.....|......||   :...|:.|.  :|.::....|..:..:|.::.:.
  Rat   563 LIENILKQVDSPNHSGQTLYDQVAFTHP---SWDAEVIQP--LPMDSSAYSFTAFAGVPAVEFSF 622

  Fly   299 TLNGYVY---HTKYDRF-NLIPRRTYQLTGENILALVKALA 335
            ..:..||   |||.|.: ||     :::....:.|:|.|:|
  Rat   623 MEDDRVYPFLHTKEDTYENL-----HKMLRGRLPAVVLAVA 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 46/236 (19%)
MFS 423..>624 CDD:304372
Tfr2XP_006249178.1 PA_TfR 246..436 CDD:239043 1/1 (100%)
M28_TfR 444..677 CDD:193572 42/226 (19%)
TFR_dimer 709..828 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.