DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and NAALADL2

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:329 Identity:65/329 - (19%)
Similarity:115/329 - (34%) Gaps:96/329 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 GRECNTNPEILMGFFTALMVLL---FAPFLVPLFCL-----------------FRK--SKTIISM 609
            |:|..::..|:..|..|||..:   :.|....:||.                 |:|  .|.:::.
Human   470 GQEWASSTAIITAFIRALMSKVKRGWRPDRTIVFCSWGGTAFGNIGSYEWGEDFKKVLQKNVVAY 534

  Fly   610 FGICTIVFIIFAATPIAFPYAEKTAPQR--FFAVHTARTFHNGDPASTVS----HKDSGYFV--- 665
            ..:.:.:....:..|:|.|..::...::  |.....|:.     |.:.:|    ..|:.||:   
Human   535 ISLHSPIRGNSSLYPVASPSLQQLVVEKNNFNCTRRAQC-----PETNISSIQIQGDADYFINHL 594

  Fly   666 -LPVDR----------RPHTVDDILFENTNFTKSERIDCDSEL--------------MCGFPIYS 705
             :|:.:          .|..:.:..| :|..||.|.:|....|              :...|:..
Human   595 GVPIVQFAYEDIKTLEGPSFLSEARF-STRATKIEEMDPSFNLHETITKLSGEVILQIANEPVLP 658

  Fly   706 SRWLNAVDNSYFV----PGPEPNREYIPTLTILEKSSNSDTNIRFDLEISGPDHTSIFILPLNDS 766
               .||:|.:..|    .|.:||...:..:.:         .:|...|:...|.    :.|.||.
Human   659 ---FNALDIALEVQNNLKGDQPNTHQLLAMAL---------RLRESAELFQSDE----MRPANDP 707

  Fly   767 K---LVDWSFIRDPLDGNVK--------PPYYVYWSYALDPKPLQFSL---EFEHEDPNWSGGTF 817
            |   .:....:.|.|....|        |.:|....|.||.|..:||:   .:||..|..|..|.
Human   708 KERAPIRIRMLNDILQDMEKSFLVKQAPPGFYRNILYHLDEKTSRFSILIEAWEHCKPLASNETL 772

  Fly   818 KIAL 821
            :.||
Human   773 QEAL 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497
MFS 423..>624 CDD:304372 13/78 (17%)
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169
Zinc_peptidase_like 437..659 CDD:301362 33/197 (17%)
TFR_dimer 686..>744 CDD:282153 12/70 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.