DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and SPBC354.09c

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_595233.1 Gene:SPBC354.09c / 2540952 PomBaseID:SPBC354.09c Length:794 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:42/197 - (21%)
Similarity:80/197 - (40%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGQFIGERAENTLLRLSKIGPKVVGSAANEQVAVQFL--LSEIGDIIDDAR--TDLYDIEKDVQV 117
            ||....|.......:.:.:.|.:|.........::.|  |...|.::.|:.  .||..:..:|..
pombe   339 PGWSAHEETNRISPKDANVLPSIVSIPITFNDGIELLKRLQGHGHLVKDSNWCQDLAPVLSEVWT 403

  Fly   118 ASGNYLLWSMVNVYQSIQ------NVVVKLSPKNATSEAALLINSHFDSVPGSSGAGDAGMMCVI 176
            .|........|||.|.|:      |::.::.  ...|:..|::.:..||  ..:||.|:.:...:
pombe   404 GSKISSPGLEVNVLQDIEDKQKIINIMAQID--GYESDQILVVGAPRDS--WCTGASDSSVGTSL 464

  Fly   177 MLEVLRVITKYETPLTY----SVVFLFNGAEENPLQGSHAFITQHPWAQNIR----AVINLDSAG 233
            :::|:.........|::    ::||....|.:....||..|:..  |.:::.    |.||:|.|.
pombe   465 LIDVISTFANMAQDLSWKPRRTIVFASWDARQFNAIGSTEFLEY--WKESLEAKAVAYINVDVAV 527

  Fly   234 SG 235
            ||
pombe   528 SG 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 42/197 (21%)
MFS 423..>624 CDD:304372
SPBC354.09cNP_595233.1 Zinc_peptidase_like 139..>191 CDD:301362
Peptidases_S8_S53 197..416 CDD:299169 14/76 (18%)
M28_PMSA_TfR_like 424..644 CDD:193496 24/112 (21%)
TFR_dimer 675..792 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.