DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and FOLH1

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_016872921.1 Gene:FOLH1 / 2346 HGNCID:3788 Length:805 Species:Homo sapiens


Alignment Length:378 Identity:82/378 - (21%)
Similarity:132/378 - (34%) Gaps:97/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSFHRMPQLKTLEDERQQPGQFIGERAENTLLRLSKIG-PKVVGSAANEQVAVQFLLSEIG-DII 101
            |:.:..|.:|:..|....||   |......:|.|:..| |...|..|||....:.:...:| ..|
Human   286 PADYFAPGVKSYPDGWNLPG---GGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSI 347

  Fly   102 DDARTDLYDIEKDVQVA------------------------SGNYLLWSM------VNVYQSIQN 136
            .......||.:|.::..                        :||:....:      .|....|.|
Human   348 PVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYN 412

  Fly   137 VVVKLSPKNATS-EAALLINSHFDS-----VPGSSGAGDAGMMCVIMLEVLR---VITKYETPLT 192
            |:..|  :.|.. :..:::..|.||     :...|||       .::.|::|   .:.|......
Human   413 VIGTL--RGAVEPDRYVILGGHRDSWVFGGIDPQSGA-------AVVHEIVRSFGTLKKEGWRPR 468

  Fly   193 YSVVFLFNGAEENPLQGSHAFITQHPWA-QNIR-------AVINLDSAGSGGREILFQSGPDHPW 249
            .:::|....|||..|.||    |:  || :|.|       |.||.||:..|...:.....|....
Human   469 RTILFASWDAEEFGLLGS----TE--WAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYS 527

  Fly   250 LMKYYGKNIVHPFASTIGEELFQN----------------GFVPSETDYRVFRDYGHIPGLDMAQ 298
            |:....|.:..|.....|:.|:::                ..:.|..|:.||.....|.......
Human   528 LVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARY 592

  Fly   299 TLN-------GY-VYHTKYDRFNLI-----PRRTYQLTGENIL-ALVKALANA 337
            |.|       || :||:.|:.:.|:     |...|.||...:. .:|..|||:
Human   593 TKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANS 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 78/360 (22%)
MFS 423..>624 CDD:304372
FOLH1XP_016872921.1 Zinc_peptidase_like 113..>169 CDD:301362
PA_GCPII_like 175..401 CDD:239036 22/117 (19%)
M28_PSMA_like 403..650 CDD:193568 60/258 (23%)
TFR_dimer 687..802 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.