DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and AgaP_AGAP001264

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_321888.3 Gene:AgaP_AGAP001264 / 1281913 VectorBaseID:AGAP001264 Length:487 Species:Anopheles gambiae


Alignment Length:129 Identity:31/129 - (24%)
Similarity:48/129 - (37%) Gaps:19/129 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QNVVVKLSPKNATSEAALLINSHFDSVPGSSGAGDAGMMCVIMLEVLRVITKYE-TPLTYSVVFL 198
            :|.:.:|.....|..:.::::.|.||.....||.|.|...:|..:.|..:.... .|.......|
Mosquito   278 RNTIGELVGTTYTDTSVVVVSGHLDSWDVGVGAMDDGGGAMISWKALTYLKAMGLRPRRTIRAIL 342

  Fly   199 FNGAEENPLQGSHAFITQH-PWAQN-----IRAVI------NLDSAGSGGREILFQS-----GP 245
            :.|.||. |.|..|:...| |..|.     ..:.|      .||..|:...|.:|:.     ||
Mosquito   343 WTGEEEG-LYGGAAYKEAHKPQEQKEFNFFFESDIGTFEPRGLDFVGNADAECIFREIVKLMGP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 31/129 (24%)
MFS 423..>624 CDD:304372
AgaP_AGAP001264XP_321888.3 M28_Pgcp_like 55..463 CDD:193504 31/129 (24%)
PA_M28_2 138..265 CDD:240119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.