DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and LOC100330918

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_002665878.5 Gene:LOC100330918 / 100330918 -ID:- Length:354 Species:Danio rerio


Alignment Length:367 Identity:88/367 - (23%)
Similarity:161/367 - (43%) Gaps:31/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 MLCIGFYTLS-VLINLVTKAHKTNFLWLIPHCICQVLPFMFYTYCCYAFYVVFVPMQGRE-CNTN 573
            |:.:.|..|| ||:....:|...:..:.:.:.:...:|::...:..:..:.:|.|:.||. ....
Zfish     1 MMMVVFPLLSKVLLRTHFRAKGASLQYSVFYLMGLSVPYVHIMFLIWVVFEIFTPILGRSGTEIP 65

  Fly   574 PEILMGFFTALMVLLFAPFLVPLFCLFRKSKTIISMFGICTIVFIIFAATPIAFPYA---EKTAP 635
            |::::.....|..::.:.:|:.|..|...:|.:::..|....|..:.....:.|||:   ....|
Zfish    66 PDVVLAALITLAAVILSSYLMHLLYLSCSTKRMLAALGSVFAVMFVLVGCGLFFPYSADPSSPRP 130

  Fly   636 QRFFAVHTARTFHNGDPASTVSHKDSGYFVLPVDRRPHT-VDDILFENTNFTKSERIDCDSEL-M 698
            :|.|..||.|.||..|  .:|...|||.::..:|   :| :..|.........|.|..|...| .
Zfish   131 KRVFVQHTTRVFHALD--GSVERSDSGLWINSLD---YTGMQHISAHVPQLNDSIRTRCQHTLPY 190

  Fly   699 CGFPIYSSRWL----NAVDNSYFVPGPEPNREYIPTLTILEKSSNSDTNIRFDLEISGPDHTSIF 759
            ||||     |.    ..|..|:::|.|..:.|......:|.:..:....:|...|..||.|.|::
Zfish   191 CGFP-----WFLPVKFLVKKSWYLPAPAVSPEAPLEFRLLSRQQSEWGTLRLSFEAKGPTHMSLY 250

  Fly   760 ILPLNDSKLVDWSF----IRDPLDGNVKPPYYVYWSYALDPKPLQFSLEFEH--EDPNWSGGTFK 818
            :||::.:.|:.|||    .|..|.|.    |::::|:..|....:||||.:.  .|.:...|...
Zfish   251 LLPVSGASLIGWSFGDGTPRFDLSGE----YFIFYSHGTDAPAWRFSLEVQPGVSDASPDEGLLS 311

  Fly   819 IALMGHRIHDDMYITEDFREFLATFPPWAHVSSWLGSYNSWQ 860
            :|:..|........:......::|||.||..|:|..:|:.::
Zfish   312 LAISAHYFSGPDKHSPPLHTLISTFPDWAFPSAWSSTYHMYR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497
MFS 423..>624 CDD:304372 20/114 (18%)
LOC100330918XP_002665878.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D152011at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.