DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9416 and NAALADL1

DIOPT Version :9

Sequence 1:NP_001261088.1 Gene:CG9416 / 37223 FlyBaseID:FBgn0034438 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_005459.2 Gene:NAALADL1 / 10004 HGNCID:23536 Length:740 Species:Homo sapiens


Alignment Length:367 Identity:80/367 - (21%)
Similarity:127/367 - (34%) Gaps:115/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WYWAPLFV--SCWFLLF------YLVVIPSFHRMPQLKTLEDERQQPGQFIG-ERAENTLLRLS- 73
            ||..|..|  ..::..|      ||..:||..|: .|..:......|.|.|| :.|.:.|..|: 
Human   237 WYLPPSGVERGSYYEYFGDPLTPYLPAVPSSFRV-DLANVSGFPPIPTQPIGFQDARDLLCNLNG 300

  Fly    74 ---------------KIGPKVVGSAANEQVAVQFLLSEIGDIIDDARTDLYDIEKDVQVASGNYL 123
                           ::||                         ..|.|            |::.
Human   301 TLAPATWQGALGCHYRLGP-------------------------GFRPD------------GDFP 328

  Fly   124 LWSMVNVYQSIQNVVVKLSPKNATS-----------EAALLINSHFDSVPGSSGAGDAGMMCVIM 177
            ..|.|||  |:.|   :|..:|:::           :..:|..:|.||  ...||.|......::
Human   329 ADSQVNV--SVYN---RLELRNSSNVLGIIRGAVEPDRYVLYGNHRDS--WVHGAVDPSSGTAVL 386

  Fly   178 LEVLRVITKYETPLTY----SVVFLFNGAEENPLQGSHAFITQ--HPWAQNIRAVINLDSAGSGG 236
            ||:.||:.......|:    |:||...||||..|.||..|..:  :...:...|.||:|.:....
Human   387 LELSRVLGTLLKKGTWRPRRSIVFASWGAEEFGLIGSTEFTEEFFNKLQERTVAYINVDISVFAN 451

  Fly   237 REILFQSGPDHPWLMKYYGKNIVHPFASTIGEELFQN------------GFVPS------ETDYR 283
            ..:..|..|....::....|.|..|....:  .::.|            |.|||      .:||.
Human   452 ATLRVQGTPPVQSVVFSATKEIRSPGPGDL--SIYDNWIRYFNRSSPVYGLVPSLGSLGAGSDYA 514

  Fly   284 VFRDYGHIPGLDMAQTLNGY--------VYHTKYDRFNLIPR 317
            .|..:..|..:|:|.|.:..        .|||.:|.|:.:.:
Human   515 PFVHFLGISSMDIAYTYDRSKTSARIYPTYHTAFDTFDYVDK 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9416NP_001261088.1 M28_Fxna_like 57..364 CDD:193497 69/321 (21%)
MFS 423..>624 CDD:304372
NAALADL1NP_005459.2 Zinc_peptidase_like 46..>121 CDD:387401
PA_GCPII_like 109..335 CDD:239036 25/135 (19%)
M28_PSMA_like <348..587 CDD:349942 49/213 (23%)
TFR_dimer 616..735 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.