DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and VPS70

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:76/347 - (21%)
Similarity:130/347 - (37%) Gaps:74/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 MTISYTNLSNVVVKISQKSSDNENYLLVNSHYDSEVQTPAAGDDGVMVVVMLETLRVISRSERTL 196
            :|.:...:|:|.|.|....::.|  :::.:|.|| :.:.:|||......::||..|.:|   :.|
Yeast   417 LTYNIKEMSSVEVSIPGIFTEGE--IIIGAHRDS-LASSSAGDANSGSAILLEIARGMS---KLL 475

  Fly   197 TH------PVVFLFNGAEEACMLGSHGFITQHKWSKNCKALV--NLDSTGAGGREVLFQTGPNHP 253
            .|      |:..:....|.:.:|||..:...|......:|||  |||:..:|..   |....|..
Yeast   476 KHGWKPLRPIKLISWDGERSGLLGSTDYAEAHAAILRRRALVYLNLDNAISGTN---FHCKANPL 537

  Fly   254 WLAKYYQASVPHPYAQTLAE-------ELFQH---------NFIPSDTDFRIFRDYGGVPGLDM- 301
            .....|:|:       .|.|       .||.|         :.:...:.:..|:.:.|||.... 
Yeast   538 LQDVIYEAA-------KLTEFNGHEDWSLFDHWKYTSNATISLLDGLSSYTSFQYHLGVPAAHFQ 595

  Fly   302 --ASVMNGYVYHTE--FDN------FKNVEYGTYQSTGENVLPLIWALANAPELDNTTAYEKGHT 356
              |:..:|.|||:.  ||:      |.|.:|..:     |.:.:...|......:|..|....|.
Yeast   596 FNANDTSGAVYHSNSVFDSPTWLEKFTNSDYKLH-----NTMAMFVGLTTLMLSENELARFNTHV 655

  Fly   357 VYYDFLGWFMMTYTESVSIAI---NVVVSVAAFICIGTSVYIMTLDNGADAPKAVVLRFAIIFLV 418
            .......|: :.:..::|.|.   :.|.|:|..:              .|..|......:|.|..
Yeast   656 YLKKIYNWY-IAWHSNLSSAFPQDDEVNSLAKRV--------------LDLLKVATQEDSIQFDQ 705

  Fly   419 QAGTLFVACGLTLLVAVFMQGV 440
            |.|.|:..|...|.|..|.:.:
Yeast   706 QNGILYKECREALPVWAFYKKI 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 60/271 (22%)
MATE_like 361..>604 CDD:298879 17/83 (20%)
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036
M28_PMSA_TfR_like 419..649 CDD:349871 56/250 (22%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.