DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and Naaladl1

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 / 83568 RGDID:620987 Length:745 Species:Rattus norvegicus


Alignment Length:370 Identity:80/370 - (21%)
Similarity:139/370 - (37%) Gaps:95/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NLSNVVVKISQKSSDNENYLLVNSHYDSEVQ---TPAAGDDGVMVVVMLETLRVIS--------R 191
            |.|| |:.|.|.:.:.:.|::..:|.||.|.   .|::|     ..|:||..||:.        |
  Rat   350 NSSN-VLGIIQGAVEPDRYVIYGNHRDSWVHGAVDPSSG-----TAVLLEISRVLGTLLKKGTWR 408

  Fly   192 SERTLTHPVVFLFNGAEEACMLGSHGFITQ--HKWSKNCKALVNLD-------STGAGG----RE 243
            ..|:    ::|...||||..::||..|..:  .|..:.....:|:|       :..|.|    :.
  Rat   409 PRRS----IIFASWGAEEFGLIGSTEFTEEFLSKLQERTVTYINVDISVFSNATLRAQGTPPVQS 469

  Fly   244 VLFQ-----TGPNHPWLA------KYYQASVPHPYAQTLAEELFQHNFIPS------DTDFRIFR 291
            |:|.     :.|....|:      :|...|.|            .:..:||      .:|:..|.
  Rat   470 VIFSATKEISAPGSSGLSIYDNWIRYTNRSSP------------VYGLVPSMGTLGAGSDYASFI 522

  Fly   292 DYGGVPGLDMA--------SVMNGYVYHTEFDNFKNVE------YGTYQSTGENVLPLIWALANA 342
            .:.|:..:|:|        |......|||.||.|..||      :.::|:.......::..|:::
  Rat   523 HFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRLSDS 587

  Fly   343 PELD-NTTAYEKGHTVYYDFLGWFMMTYTESVSIAIN-VVVSVAAFICIGTSV--YIMTLDNGAD 403
            ..|. |.:.|.:....:.......:....||.:|::. :|.:|..|.....::  :|:||...:.
  Rat   588 LFLPLNVSDYSETLQSFLQAAQENLGALLESHNISLGPLVTAVEKFKAAAAALNQHILTLQKSSP 652

  Fly   404 APKAVVLRFAIIFLVQAGTLFVACGLTLLVAVFMQGVGLAESWYY 448
            .|..|.:              |...|.||...|:......|..||
  Rat   653 DPLQVRM--------------VNDQLMLLERAFLNPRAFPEERYY 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 61/286 (21%)
MATE_like 361..>604 CDD:298879 19/91 (21%)
Naaladl1NP_113947.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 119..331 CDD:239036
M28_PSMA_like <353..592 CDD:349942 57/260 (22%)
TFR_dimer 621..740 CDD:367885 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.