DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and Cpq

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_061225.2 Gene:Cpq / 54381 MGIID:1889205 Length:470 Species:Mus musculus


Alignment Length:320 Identity:71/320 - (22%)
Similarity:128/320 - (40%) Gaps:45/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SYPKMLYQSEEA-----LHPDKFIGERAMRQLAEYSAIGNKMSGSINNEVHTI-NFLLRE----I 102
            |:.::..::.||     ::...:.|.....|.....|:.....|::.:.:.:: :|.:..    |
Mouse   153 SFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGI 217

  Fly   103 QKIKD------EARLDLYDIEVDTQYSSG----AFHL--WGMTISYTNLSNVVVKISQKSSDNEN 155
            ||.:|      .|.:.:.|.|:.::.:|.    ..||  ...|...|:..|.|.:|: .|...|.
Mouse   218 QKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEIT-GSMYPEE 281

  Fly   156 YLLVNSHYDSEVQTPAAGDDGVMVVVMLETLRVIS----RSERTLTHPVVFLFNGAEEACMLGSH 216
            .:||:.|.||......|.|||....:..|.|.::.    |.:|||.   :.|:. |||...:|:.
Mouse   282 VVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLR---LVLWT-AEEQGGIGAS 342

  Fly   217 GFITQHKWSKNCKALVNLDSTGAGGREVLFQTGPNHPWLAKYYQASVPHPYAQTLAEELFQHNFI 281
            .:...||.:.:..:||....:|......|..||.:.   |:.....|.:........::|. |..
Mouse   343 QYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDK---ARAIMKEVMNLLQPLNVTKVFS-NGE 403

  Fly   282 PSDTDFRIFRDYGGVPGLDMASVMNGYVY--HTEFDNFKNVEYGTYQSTGENVLPLIWAL 339
            .:|.:|.|   ..||||..:...:..|.:  |:..|....::     ....||...:||:
Mouse   404 GTDINFWI---QAGVPGASLRDDLYKYFFFHHSHGDTMTVMD-----PKQMNVAAAVWAV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 68/301 (23%)
MATE_like 361..>604 CDD:298879
CpqNP_061225.2 M28_Pgcp_like 45..447 CDD:193504 67/310 (22%)
PA_M28_2 128..254 CDD:240119 16/100 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.