DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and Tfr2

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_030110515.1 Gene:Tfr2 / 50765 MGIID:1354956 Length:840 Species:Mus musculus


Alignment Length:219 Identity:50/219 - (22%)
Similarity:95/219 - (43%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TNLSNVVVKISQKSSDNENYLLVNSHYDSEVQTPAAGDDGVMVVVMLETLRVIS-------RSER 194
            |.:||:...| :..::.::|:::.:..|:  ..|.|....|...::||.:|..|       |..|
Mouse   445 TPISNIFACI-EGFAEPDHYVVIGAQRDA--WGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRR 506

  Fly   195 TLTHPVVFL-FNGAEEACMLGSHGFITQHKWSK------NCKAL--VNLDSTGAGG--------- 241
            :|    :|: ::|       |..|.:...:|.:      :.||:  |:||::..|.         
Mouse   507 SL----LFISWDG-------GDFGSVGATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSP 560

  Fly   242 ------REVLFQT-GPNHPWLAKYYQASVPHPYAQTLAEELFQHNFIPSDTDFRIFRDYGGVPGL 299
                  ..:|.|. .|||.....|.|.::.||   :...|:.|.  :|.|:....|..:.|||.:
Mouse   561 LLVSLIENILKQVDSPNHSGQTLYEQVALTHP---SWDAEVIQP--LPMDSSAYSFTAFAGVPAV 620

  Fly   300 DMASVMNGYVY---HTEFDNFKNV 320
            :.:.:.:..||   ||:.|.::|:
Mouse   621 EFSFMEDDRVYPFLHTKEDTYENL 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 50/219 (23%)
MATE_like 361..>604 CDD:298879
Tfr2XP_030110515.1 PA_TfR 248..438 CDD:239043
M28_TfR 446..679 CDD:349946 49/218 (22%)
TFR_dimer 706..830 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.