DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and NAALADL2

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:306 Identity:57/306 - (18%)
Similarity:102/306 - (33%) Gaps:117/306 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NNEVHTINFLLREIQKIKDEARLDLYDIEVDTQYSSGAFHLWGMTISYTNLSNVVVKISQKSSDN 153
            |||:..::..::.:.|:|                            :.||:...|:.::..    
Human   420 NNEIRVVSMQVQTVTKLK----------------------------TVTNVVGFVMGLTSP---- 452

  Fly   154 ENYLLVNSH------YDSEVQTPAAGDDGVMVVVMLETLRVISRSERTLTHPVVFLFNGAEEACM 212
            :.|::|.||      |:.:....:.......:..::..::...|.:||    :||        |.
Human   453 DRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMSKVKRGWRPDRT----IVF--------CS 505

  Fly   213 LGSHGF--ITQHKW--------SKNCKALVNLDSTGAGGREVLFQTGPNHPWLAKYYQASVPHPY 267
            .|...|  |..::|        .||..|.::|.|...|...:       :|         |..|.
Human   506 WGGTAFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSL-------YP---------VASPS 554

  Fly   268 AQTLAEELFQHNF-----------------IPSDTDFRIFRDYGGVPGLDMA----------SVM 305
            .|.|..|  ::||                 |..|.|:  |.::.|||.:..|          |.:
Human   555 LQQLVVE--KNNFNCTRRAQCPETNISSIQIQGDADY--FINHLGVPIVQFAYEDIKTLEGPSFL 615

  Fly   306 NGYVYHT------EFDNFKNVEYGTYQSTGENVLPLIWALANAPEL 345
            :...:.|      |.|...|:.....:.:||.:|    .:||.|.|
Human   616 SEARFSTRATKIEEMDPSFNLHETITKLSGEVIL----QIANEPVL 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 57/306 (19%)
MATE_like 361..>604 CDD:298879
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169 57/306 (19%)
Zinc_peptidase_like 437..659 CDD:301362 53/289 (18%)
TFR_dimer 686..>744 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.