DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and B0495.7

DIOPT Version :10

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_495618.1 Gene:B0495.7 / 174245 WormBaseID:WBGene00015206 Length:895 Species:Caenorhabditis elegans


Alignment Length:87 Identity:22/87 - (25%)
Similarity:40/87 - (45%) Gaps:15/87 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 MNIDLQQRANEFSQLFTNYKHLRTSLLEKMPKL--------KLSELTTSEYNADFASGESSEVEQ 338
            :|..|......|:|  |:.:...||.||..|.|        .:|::..|:.:....|...|:..|
 Worm   114 VNKQLNSCPENFTQ--TSREADSTSSLEISPALDSVKPMGSSVSKVVMSDKSKQVESSTDSDSLQ 176

  Fly   339 QQ--QEEPVPAP---EPSNQDI 355
            |:  ::|.:.:|   |.:|::|
 Worm   177 QKSDEKEEILSPRSAEETNKEI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:349872 22/87 (25%)
MATE_like 361..>604 CDD:447704
B0495.7NP_495618.1 M28_Fxna_like 71..382 CDD:349872 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.