DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and CPQ

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_057218.1 Gene:CPQ / 10404 HGNCID:16910 Length:472 Species:Homo sapiens


Alignment Length:307 Identity:72/307 - (23%)
Similarity:123/307 - (40%) Gaps:35/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FYSYPKML-YQSEEALHPDKFIGERA--MRQLAEYSAIGNKMSG--SINNEVHTINFLLREIQKI 105
            :.:|.:.: |:::.|:...| :|..|  :|.:|.:| |.:..:|  ...:.|..|......::..
Human   177 YINYSRTVQYRTQGAVEAAK-VGALASLIRSVASFS-IYSPHTGIQEYQDGVPKIPTACITVEDA 239

  Fly   106 KDEARLDLYDIEVDTQYSSGAFHLWGMTISYTNLSNVVVKISQKSSDNENYLLVNSHYDSEVQTP 170
            :..:|:..:.|::..|...||     .|...|:..|.|.:|: .|...|..:||:.|.||.....
Human   240 EMMSRMASHGIKIVIQLKMGA-----KTYPDTDSFNTVAEIT-GSKYPEQVVLVSGHLDSWDVGQ 298

  Fly   171 AAGDDGVMVVVMLETLRVIS----RSERTLTHPVVFLFNGAEEACMLGSHGFITQHKWSKNCKAL 231
            .|.|||....:..|.|.:|.    |.:|||.   :.|:. |||...:|:..:...||.:.:..:|
Human   299 GAMDDGGGAFISWEALSLIKDLGLRPKRTLR---LVLWT-AEEQGGVGAFQYYQLHKVNISNYSL 359

  Fly   232 VNLDSTGAGGREVLFQTGPNHPWLAKYYQASVPHPYAQTLAEELFQHNFIPSDTDFRIFRDYGGV 296
            |.....|......|..||............|:..|...|   ::..|.   ..||.. |....||
Human   360 VMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNIT---QVLSHG---EGTDIN-FWIQAGV 417

  Fly   297 PGLDMASVMNGYVY--HTEFDNFKNVEYGTYQSTGENVLPLIWALAN 341
            ||..:...:..|.:  |:..|....::     ....||...:||:.:
Human   418 PGASLLDDLYKYFFFHHSHGDTMTVMD-----PKQMNVAAAVWAVVS 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497 69/290 (24%)
MATE_like 361..>604 CDD:298879
CPQNP_057218.1 M28_Pgcp_like 47..449 CDD:193504 68/295 (23%)
PA_M28_2 130..256 CDD:240119 15/80 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.