DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10051 and LOC100330918

DIOPT Version :9

Sequence 1:NP_611414.1 Gene:CG10051 / 37222 FlyBaseID:FBgn0034437 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_002665878.5 Gene:LOC100330918 / 100330918 -ID:- Length:354 Species:Danio rerio


Alignment Length:365 Identity:82/365 - (22%)
Similarity:162/365 - (44%) Gaps:54/365 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 VLVQIVLKLTLKKSY--------FVTVHLLFQVLPFFFYTYICYATLVTFVPMEGRDGPESSPDI 584
            |:..::.|:.|:..:        :...:|:...:|:....::.:.....|.|:.||.|.|..||:
Zfish     4 VVFPLLSKVLLRTHFRAKGASLQYSVFYLMGLSVPYVHIMFLIWVVFEIFTPILGRSGTEIPPDV 68

  Fly   585 MISVFIIATAINYAGFVIPIMHKFRKPKIIFSSFG-VITIIFIILACTSAGFPFVKQLA---PQR 645
            :::..|...|:..:.:::.:::.....|.:.::.| |..::|:::.| ...||:....:   |:|
Zfish    69 VLAALITLAAVILSSYLMHLLYLSCSTKRMLAALGSVFAVMFVLVGC-GLFFPYSADPSSPRPKR 132

  Fly   646 YYVLHTQRTFHNLDGT-SKQDSGYYI--------QPVDTRLHELDDTTFKNAEPESWTAATCAAE 701
            .:|.||.|.||.|||: .:.|||.:|        |.:...:.:|:|:.....:         ...
Zfish   133 VFVQHTTRVFHALDGSVERSDSGLWINSLDYTGMQHISAHVPQLNDSIRTRCQ---------HTL 188

  Fly   702 PYCGLPLYSGRW---IEWKDSARWIYSSP---PVIPMNINLTQLSKQSLDGNKVRYEYNLRASDR 760
            ||||.|     |   :::.....|...:|   |..|:...|  ||:|..:...:|..:..:....
Zfish   189 PYCGFP-----WFLPVKFLVKKSWYLPAPAVSPEAPLEFRL--LSRQQSEWGTLRLSFEAKGPTH 246

  Fly   761 VMMYIDPLDNVKVTDWSF-DHTPLVEKHTPPYLIYAIYSQTEEPLNFW-VELEHEEGNTDGP--- 820
            :.:|:.|:....:..||| |.||..:.....::.|:  ..|:.|.  | ..||.:.|.:|..   
Zfish   247 MSLYLLPVSGASLIGWSFGDGTPRFDLSGEYFIFYS--HGTDAPA--WRFSLEVQPGVSDASPDE 307

  Fly   821 -YMKLVVSEHFQYHPEYYTEEYKEFLATFPDWTYTTDWFS 859
             .:.|.:|.|:...|:.::......::|||||.:.:.|.|
Zfish   308 GLLSLAISAHYFSGPDKHSPPLHTLISTFPDWAFPSAWSS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10051NP_611414.1 M28_Fxna_like 62..369 CDD:193497
MATE_like 361..>604 CDD:298879 15/83 (18%)
LOC100330918XP_002665878.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D152011at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.