DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and APE3

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:61/295 - (20%)
Similarity:115/295 - (38%) Gaps:75/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 QKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGP 196
            :|:.:..|.:|:..:..|..|||.      :...|||:.  ..|:.:....:.:.:|.|||..||
Yeast   266 KKLIANIALNIDYSLYFAMDSYVE------FIKTQNIIA--DTKHGDPDNIVALGAHSDSVEEGP 322

  Fly   197 GAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAF---ITQHKWAKYCKALI 258
            |..||||...:::.|.:.|  :...:.|.|.|.:..|||..|..|:.:   :|:.:.:| .:..:
Yeast   323 GINDDGSGTISLLNVAKQL--THFKINNKVRFAWWAAEEEGLLGSNFYAYNLTKEENSK-IRVFM 384

  Fly   259 NLDSCGNGGREILFQSGPNHPWLMKNYR--------RAIKHPYASTMGEELFQHNFIPSD--TDF 313
            :.|          ..:.||:.:.:.:..        ..:|:.|..........:..:|.|  :|:
Yeast   385 DYD----------MMASPNYEYEIYDANNKENPKGSEELKNLYVDYYKAHHLNYTLVPFDGRSDY 439

  Fly   314 RIFRDHGSVPG----------------LDMAY----------TYNGFVYHTR---H------DKA 343
            ..|.::|...|                ||..|          :::.|:.:|:   |      |..
Yeast   440 VGFINNGIPAGGIATGAEKNNVNNGKVLDRCYHQLCDDVSNLSWDAFITNTKLIAHSVATYADSF 504

  Fly   344 EIFPRGSFQ-HTGDNLLALVRQIANSPEIENSAKY 377
            |.||:...| |...::|.     |..|:.:..|.:
Yeast   505 EGFPKRETQKHKEVDILN-----AQQPQFKYRADF 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 61/295 (21%)
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 52/260 (20%)
PA_ScAPY_like 155..284 CDD:239045 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.