DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and YDR415C

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_010703.1 Gene:YDR415C / 852024 SGDID:S000002823 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:83/343 - (24%)
Similarity:121/343 - (35%) Gaps:106/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDIEVD-VQVASGSYVHWSMVNMYQS 164
            |||.:..|...|...| .:...:.:.|:..:..|    ..||..| :.:....:..|..      
Yeast   102 KNLAKFTSFYTRYYKS-DHGFESAEWLAATIANI----TKDIPQDTLTIEHFDHKEWKQ------ 155

  Fly   165 IQNIVVKISPKNTNSTT---YLLVNSHYD-------SVPAGPGAGDDGSMVATMMEVLRV----- 214
             .:|:|::    |.|||   .:::.||.|       |:.|.|||.|:||...|.||.||:     
Yeast   156 -YSIIVRV----TGSTTPEDIIIIGSHQDSINLLLPSIMAAPGADDNGSGTVTNMEALRLYTENF 215

  Fly   215 LAKSDKPLKNPVVFLFNGAEENPLQAS-HAFITQHKWAKYCKALINLDSCGNGGREILFQSGP-- 276
            |.:..:| .|.|.|.|..|||..|..| ..|....|..|:.:|::..|..|       :.|.|  
Yeast   216 LKRGFRP-NNTVEFHFYSAEEGGLLGSLDVFTAYAKQKKHVRAMLQQDMTG-------YVSDPED 272

  Fly   277 NHPWLMKNY-------------RRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMA 328
            .|..::.:|             ...:..||..|      |..:..|        ||||.      
Yeast   273 EHVGIVTDYTTPALTDFIKLIINSYLSIPYRDT------QCGYACS--------DHGSA------ 317

  Fly   329 YTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLV 393
             |.|||             .|||             :..| |.:.:.||........|.:.  |.
Yeast   318 -TRNGF-------------PGSF-------------VIES-EFKKTNKYIHSTMDTLDRLS--LA 352

  Fly   394 FYTETEGVILNVIVSLVS 411
            ...|...::|.||:.|.|
Yeast   353 HMAEHTKIVLGVIIELGS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 77/325 (24%)
YDR415CNP_010703.1 M28_AAP 81..369 CDD:349875 81/340 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.