DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and Naalad2

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001344328.1 Gene:Naalad2 / 72560 MGIID:1919810 Length:778 Species:Mus musculus


Alignment Length:393 Identity:82/393 - (20%)
Similarity:129/393 - (32%) Gaps:125/393 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RLP--RPLTIQDEETHPDQFIAERAEKNLREL-----------------VSLGPRVVGSRQNEMA 122
            |||  ..:.|.:...||..:  ..||:.||.|                 .::||...||..:   
Mouse   308 RLPVEEAVGIPNIPVHPIGY--NDAERLLRNLGGAAPPDKSWKGSLNVSYNIGPGFTGSEYS--- 367

  Fly   123 ALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNS 187
                     :.||                  :|.:.:|....|.|::..|. .:|....|:::..
Mouse   368 ---------RNIR------------------MHVNNINKITRIYNVIGTIR-GSTEPDRYVILGG 404

  Fly   188 HYDSVPAG---PGAGDDGSMVATMMEVLRVLAK----SDKPLKNPVVFLFNGAEENPLQASHAFI 245
            |.||...|   |..|     .|.:.|:.|...|    ..:| :..::|....|||..|..|..:.
Mouse   405 HRDSWVFGGIDPTTG-----TAVLQEIARSFGKLVNGGWRP-RRTIIFASWDAEEFGLLGSTEWA 463

  Fly   246 TQHKWAKYCK----ALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH-- 304
            .::  ||..:    |.||.||...|...:.....|....|:....|.|..|......:.|::.  
Mouse   464 EEN--AKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFESKSLYESWL 526

  Fly   305 --------------NFIPSDTDFRIFRDHGSVPGLDMAYT-------YNGF-VYHTRHDKAEIFP 347
                          |.:.|.:||..:.....:......||       |:.: ||||.::..|:. 
Mouse   527 EKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELV- 590

  Fly   348 RGSFQHTGDNLL-------ALVRQIANSPEIE-NSAKYAK---------------------GHTI 383
            :..:..|....|       |||.::|:|..|. |...|||                     .|.:
Mouse   591 QNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAASIFNISKKHDQQLRNHAV 655

  Fly   384 YFD 386
            .||
Mouse   656 SFD 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 77/377 (20%)
Naalad2NP_001344328.1 Zinc_peptidase_like 86..>142 CDD:326366
PA_GCPII_like 148..374 CDD:239036 17/97 (18%)
M28_PSMA_like 376..623 CDD:193568 57/256 (22%)
TFR_dimer 660..771 CDD:309400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.