DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and Naaladl1

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001009546.1 Gene:Naaladl1 / 381204 MGIID:2685810 Length:745 Species:Mus musculus


Alignment Length:336 Identity:70/336 - (20%)
Similarity:122/336 - (36%) Gaps:70/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 VKISPKN-----TNSTT------------YLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA- 216
            ||:|..|     |:|..            |::..:|.||..  .||.|..|..|.::|:.|||. 
Mouse   338 VKVSVHNRLELRTSSNVLGIIQGAVEPDRYVIYGNHRDSWV--HGAVDPSSGTAVLLEISRVLGT 400

  Fly   217 ---KSDKPLKNPVVFLFNGAEENPLQASHAFITQ--HKWAKYCKALINLDSCGNGGREILFQSGP 276
               |.....:..::|...||||..|..|..|..:  .|..:...|.||:|........:..|..|
Mouse   401 LLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVAYINVDISVFSNATLRAQGTP 465

  Fly   277 NHPWLMKNYRRAIKHPYASTMGEELFQ------------HNFIPS------DTDFRIFRDHGSVP 323
            ....::.:..:.|..|.:|  |..::.            :..:||      .:|:..|.....:.
Mouse   466 PVQSVIFSATKEISAPGSS--GLSIYDNWIRYTNRTSPVYGLVPSLGTLGAGSDYAAFVHFLGIT 528

  Fly   324 GLDMAYTYNGF--------VYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIE-------- 372
            .:|:||||:..        .|||..|..:...:  |...|.:....|.:.|.|..:.        
Mouse   529 SMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEK--FLDPGFSSHQAVARTAGSVLLRLSDSLFLP 591

  Fly   373 -NSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKK 436
             |.:.|::....:.......|....|.:.:.|..:|:.|:      .||..:.:.|..:..:.|.
Mouse   592 LNVSDYSETLQSFLQAAQEALGTQLEKQNISLGPLVTAVA------NFKAAAASLGEHILTLQKS 650

  Fly   437 VGHTLLVQILS 447
            ....|.|::::
Mouse   651 SPDPLQVRMVN 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 60/282 (21%)
Naaladl1NP_001009546.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 114..344 CDD:239036 3/5 (60%)
M28_PSMA_like <350..592 CDD:349942 53/247 (21%)
TFR_dimer <642..739 CDD:367885 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.