DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and NAALADL2

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:314 Identity:69/314 - (21%)
Similarity:121/314 - (38%) Gaps:73/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SRQNEMAAL----------KMLSQKMQKIRSGTANDIEV---DVQVASGSYVHWSMVNMYQSIQN 167
            ||.|..:.|          |::|....:.::...:.:|:   :::|.|   :....|...:::.|
Human   380 SRSNLTSLLVQPISAPLVAKLISSPKARTKNEACSSLELPNNEIRVVS---MQVQTVTKLKTVTN 441

  Fly   168 IVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNP---VVFL 229
            :|..:... |:...|::|.||:.:..:..|. :..|..|.:...:|.|....|....|   :||.
Human   442 VVGFVMGL-TSPDRYIIVGSHHHTAHSYNGQ-EWASSTAIITAFIRALMSKVKRGWRPDRTIVFC 504

  Fly   230 FNGAEENPLQASHAF--ITQHKWAKYCK--------ALINLDSCGNGGREILFQSGPNHPWLMKN 284
            ..|..        ||  |..::|.:..|        |.|:|.|...|...:...:.|:...|:..
Human   505 SWGGT--------AFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLYPVASPSLQQLVVE 561

  Fly   285 YRRAIKHPYASTMGEELFQHNF----IPSDTDFRIFRDHGSVPGLDMAY----TYNG--FV---- 335
                 |:.:..|...:..:.|.    |..|.|:  |.:|..||.:..||    |..|  |:    
Human   562 -----KNNFNCTRRAQCPETNISSIQIQGDADY--FINHLGVPIVQFAYEDIKTLEGPSFLSEAR 619

  Fly   336 YHTRHDK-AEIFPRGSFQHTGDNLLA-LVRQIANSP-----------EIENSAK 376
            :.||..| .|:.|..:...|...|.. ::.||||.|           |::|:.|
Human   620 FSTRATKIEEMDPSFNLHETITKLSGEVILQIANEPVLPFNALDIALEVQNNLK 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 69/314 (22%)
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169 7/39 (18%)
Zinc_peptidase_like 437..659 CDD:301362 56/238 (24%)
TFR_dimer 686..>744 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.