DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and FOLH1

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_016872921.1 Gene:FOLH1 / 2346 HGNCID:3788 Length:805 Species:Homo sapiens


Alignment Length:415 Identity:86/415 - (20%)
Similarity:143/415 - (34%) Gaps:127/415 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFI-----AERAEKNLREL 106
            :|||:|........|  ::||   |.||.:..|      ..:::||.:.     .:|.  |:..|
Human   265 RGNKVKNAQLAGAKG--VILY---SDPADYFAP------GVKSYPDGWNLPGGGVQRG--NILNL 316

  Fly   107 VSLG-PRVVGSRQNEMAALKML------------------SQKMQKIRSGTA-------NDIEVD 145
            ...| |...|...||.|..:.:                  :||:.:...|:|       ..::|.
Human   317 NGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVP 381

  Fly   146 VQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTT-----------------YLLVNSHYDSVP 193
            ..|..|...::|...         ||:...:||..|                 |:::..|.||..
Human   382 YNVGPGFTGNFSTQK---------VKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWV 437

  Fly   194 AGPGAGDDGSMVATMMEVLR---VLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCK 255
            .  |..|..|..|.:.|::|   .|.|.....:..::|....|||..|..|      .:||:...
Human   438 F--GGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGS------TEWAEENS 494

  Fly   256 --------ALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH-------- 304
                    |.||.||...|...:.....|....|:.|..:.:|.|.....|:.|::.        
Human   495 RLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSP 559

  Fly   305 --------NFIPSDTDFRIFRDHGSVPGLDMAYT-------YNGF-VYHTRHDKAEIF-----PR 348
                    :.:.|..||.:|.....:......||       ::|: :||:.::..|:.     |.
Human   560 EFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPM 624

  Fly   349 GSFQHTGDNLLALVR-----QIANS 368
            ..:..|    :|.||     ::|||
Human   625 FKYHLT----VAQVRGGMVFELANS 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 75/371 (20%)
FOLH1XP_016872921.1 Zinc_peptidase_like 113..>169 CDD:301362
PA_GCPII_like 175..401 CDD:239036 32/157 (20%)
M28_PSMA_like 403..650 CDD:193568 54/255 (21%)
TFR_dimer 687..802 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.