DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and naaladl1

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001091660.1 Gene:naaladl1 / 100000223 ZFINID:ZDB-GENE-060526-100 Length:740 Species:Danio rerio


Alignment Length:389 Identity:82/389 - (21%)
Similarity:146/389 - (37%) Gaps:93/389 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 SGSYVHWSMVNMYQSIQNI--VVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVL 212
            :.|.||....|: :.|:|.  |:.:...:.....|::..:|.||..  .||.|..|..|.|:|:.
Zfish   332 TNSTVHLDTYNI-EKIENSANVMGVIRGSVEPDRYVIYGNHRDSWV--HGAIDPSSGTAVMLEIT 393

  Fly   213 RVLAKSDKPLK----NPVVFLFNGAEENPLQASHAFITQH--KWAKYCKALINLD---------- 261
            |||.|..|..|    ..::|...||||..|..|..:..::  |.::...|.||:|          
Zfish   394 RVLGKMVKEGKWRPRRSIIFGSWGAEEFGLIGSAEYTEEYFSKLSERTVAYINVDISVFANATLR 458

  Fly   262 -SCGNGGREILFQSGPN-----------HPWLMKNYRRAIKHPYASTMGEELFQHNFIP------ 308
             |.....:.:||.:...           ..|: :.|.|...:            :..||      
Zfish   459 ASASPAAQSVLFTASKQVDAPGTTMSVYDNWI-RYYNRTSPN------------YGIIPNVGFLT 510

  Fly   309 -SDTDFRIFRDHGSVPGLDMAYTYNGF--------VYHTRHDKAE-----IFPRGSFQH-----T 354
             :.:|:..|..:..:..:|::|.|:..        .|||.:|..:     |.| |...|     |
Zfish   511 GAGSDYAAFIHYLGITSMDISYYYDQSKTRARIYPAYHTAYDTFDYASTYIDP-GFTSHQAVART 574

  Fly   355 GDNLLALVRQIANSPEIE-NSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYA 418
            ..|:|.   ::|:|..:. |.:.||:....|      |....|..|..:....:|:.|:......
Zfish   575 AGNVLL---RLADSLLLPFNCSDYAESLEQY------FAQAVTAFEAKLAAKAISMESLKKAVQF 630

  Fly   419 FKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVHLP-------LSWFSNS 475
            |:    ::..||:::::.........:.:..:...|.:|...|:|.:..|       :.|.|.|
Zfish   631 FR----DTATKLDRLIRDSDLVKETPLKARRINDQLMLLDRAFLDPLAFPDKYAFRHVIWASRS 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 67/300 (22%)
naaladl1NP_001091660.1 Zinc_peptidase_like 50..>124 CDD:301362
PA_GCPII_like 113..338 CDD:239036 2/5 (40%)
M28_PSMA_like 335..578 CDD:193568 57/259 (22%)
TFR_dimer 624..736 CDD:282153 11/71 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.