DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and SFC

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_196834.3 Gene:SFC / 831171 AraportID:AT5G13300 Length:827 Species:Arabidopsis thaliana


Alignment Length:364 Identity:76/364 - (20%)
Similarity:128/364 - (35%) Gaps:115/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FEKIEKSK--PKRLSNLEHLALDMIE---------------AGGDFGQDLPYGQALIKVGQAEQK 129
            |.|::.|.  .|:|.::|..|..:.|               .|..:..|:.:..||...|.    
plant     3 FTKLDDSPMFRKQLQSMEESAEILRERSLKFYKGCRKYTEGLGEAYDGDIAFASALETFGG---- 63

  Fly   130 LGQCEHDFIATSG---ICFTQPLRKF------LDGEMKTIGKERGILETKRLDLDACKNRVKKAR 185
             |..:...:|..|   ..||..||:.      |..:::.|..:| :|:...:||    :.||:||
plant    64 -GHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHILNDR-LLQFANMDL----HEVKEAR 122

  Fly   186 SMLGQQS-------------KDGISPE--AVLEQAERDLRVAQAEFDRQAE---ITKL------- 225
            ....:.|             :.|...:  |.|||   :|..:::.|: ||.   :|.|       
plant   123 KRFDKASLTYDQAREKFLSLRKGTKSDVAAALEQ---ELHTSRSMFE-QARFNLVTALSNVEAKK 183

  Fly   226 ---LLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYI--PLDVNEASA 285
               .|:.:|.:..:||           ||:||..:::.|::          |||  .|...:.|.
plant   184 RFEFLEAVSGTMDAHL-----------RYFKQGYELLHQME----------PYINQVLTYAQQSR 227

  Fly   286 SKSNISSGAAAR----------------GPGNNHSAN---MAATGHKPNQPMHVSTDQMQRARVL 331
            .:||....|...                ..|:|.|.|   :.|.|...::.:........|.:|.
plant   228 ERSNYEQAALNEKMQEYKRQVDRESRWGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQ 292

  Fly   332 C---SYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQ 367
            .   .|.:|..:.|........||.:...:.  |.|.||
plant   293 TIRQGYLSKRSSNLRGDWKRRFFVLDSRGML--YYYRKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 51/237 (22%)
SH3_Endophilin_B 327..378 CDD:212736 11/44 (25%)
SFCNP_196834.3 BAR_SFC_plant 14..215 CDD:153290 48/235 (20%)
PH 293..430 CDD:278594 9/39 (23%)
PH_ACAP 295..434 CDD:270070 9/37 (24%)
ArfGap 501..639 CDD:279720
ANK 711..816 CDD:238125
Ank_4 729..782 CDD:290365
ANK repeat 729..759 CDD:293786
ANK repeat 761..792 CDD:293786
Ank_4 764..816 CDD:290365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.