DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and AT4G34660

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_567969.1 Gene:AT4G34660 / 829618 AraportID:AT4G34660 Length:368 Species:Arabidopsis thaliana


Alignment Length:392 Identity:74/392 - (18%)
Similarity:130/392 - (33%) Gaps:115/392 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GTTERTEYDLH--FQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSN 95
            |..:..|.:.|  .:.|.......|.:...|||..|..::...:                     
plant    34 GLADEAELNQHQKLEKLYISTRAAKHYQRDIVRGVEGYIVTGSK--------------------- 77

  Fly    96 LEHLALDMIEAGGDFGQD-LPYG------------QALIKVGQAEQKLGQCEHDFIATSGICFTQ 147
                   .:|.|....:| ..||            :|.:..|:|..::.:...:.:...|....:
plant    78 -------QVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQMEKERGNMLKALGTQVAE 135

  Fly   148 PLRKFLDG----EMKTIGKERGILETKRLDLDA----CKNRVKKARSMLGQQSKDGISPEAV--L 202
            |||..:.|    :.:.:.:.   .:..|.:.:|    ...|..|||...|       :|:.:  |
plant   136 PLRAMVLGAPLEDARHLAQR---YDRMRQEAEAQATEVARRQAKARESQG-------NPDILMKL 190

  Fly   203 EQAERDLRVAQAEFDRQAEITKLLLDGIST-------SQASHLRHLHAFIQTQVRYYKQCGDVME 260
            |.||..|.      |.::.:|.|..:..|.       .|...|..|.:.::::..|:::...:::
plant   191 ESAEAKLH------DLKSNMTILGKEAASALASVEDQQQKLTLERLLSMVESERAYHQRVLQILD 249

  Fly   261 QLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPNQPMHVSTDQM 325
            ||:.|:           :...:...:.|..||..:...|.:...||    |...:|....|||.|
plant   250 QLEGEM-----------VSERQRIEAPSTPSSADSMPPPPSYEEAN----GVFASQMHDTSTDSM 299

  Fly   326 Q--RARVLCSYDAKDHTELNLSANEVIFVT----------ECSPVNEDYMYGKQGLLKGLVPRAF 378
            .  ...||..|......||:||..|.:.|.          ||.        ||.|..    |..:
plant   300 GYFLGEVLFPYHGVTDVELSLSTGEYVVVRKVTGSGWAEGECK--------GKAGWF----PYGY 352

  Fly   379 VE 380
            :|
plant   353 IE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 45/264 (17%)
SH3_Endophilin_B 327..378 CDD:212736 15/60 (25%)
AT4G34660NP_567969.1 BAR_SH3P_plant 45..254 CDD:153291 42/252 (17%)
SH3 303..354 CDD:418401 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2650
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.