DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and AT4G18060

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_193540.3 Gene:AT4G18060 / 827531 AraportID:AT4G18060 Length:351 Species:Arabidopsis thaliana


Alignment Length:352 Identity:75/352 - (21%)
Similarity:124/352 - (35%) Gaps:96/352 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EKIVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQD-LPYGQALIK 122
            :|:.|.|.|         .::|..:.::.::......|.|     ||||....:| ..||     
plant    51 DKLYRSTRS---------AKEFQRDIVKAAEAFTTIGLRH-----IEAGTKLSEDCCRYG----- 96

  Fly   123 VGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSM 187
             .:..|.:   :.:.:|.:...:.. .||.:|.|.:...|   :|.::.||         ..|:|
plant    97 -NENSQNI---DENILAKAAAIYGD-ARKHVDKEQEDFNK---LLASQVLD---------PLRAM 144

  Fly   188 LGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYY 252
            :.     |...|.....|:|..|:.|   :.:...|:     :|..||   |...|.|...|...
plant   145 VA-----GSPLEDARHLAQRYSRMRQ---EAETHATE-----VSRRQA---RVREAPIPENVAKL 193

  Fly   253 KQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSG----------AAARGPGNNH---- 303
            :.....|::|:..:|.||          .||:|:.:.:.|.          |...|..|.|    
plant   194 QLAEAKMQELKANMAVLG----------KEATAALAAVESQQHRLTFQRLVAMVEGEKNYHLRIA 248

  Fly   304 ------SANMAA-TGHKPNQPMHVSTDQMQR------ARVLCSYDAKDHTELNLSANEVIFVTEC 355
                  .|.|.. ..||.:.|..:.|:....      |.|:..:.|....||:|...:.|.|.:.
plant   249 AILSDIEAEMVTEKQHKESAPPAIPTENGSEKTSYFLAEVIHPFSAASEKELDLDKGDYIVVRKV 313

  Fly   356 SPVN--EDYMYGKQGLLKGLVPRAFVE 380
            |...  |....||.|..    |.|::|
plant   314 SQTGWAEGECKGKAGWF----PMAYIE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 42/207 (20%)
SH3_Endophilin_B 327..378 CDD:212736 14/58 (24%)
AT4G18060NP_193540.3 BAR 49..257 CDD:416402 53/267 (20%)
SH3 285..337 CDD:418401 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2650
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.