DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and SH3GL2

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_011516307.1 Gene:SH3GL2 / 6456 HGNCID:10831 Length:386 Species:Homo sapiens


Alignment Length:369 Identity:84/369 - (22%)
Similarity:150/369 - (40%) Gaps:56/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFIFEKIEK----SKP 90
            ||:|..|.|:.|..|:.:..:.|||.....:|:..|...|.|||.:|.:..:...:.|    .|.
Human    53 EKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKG 117

  Fly    91 KRLSNLEHLALD-MIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLD 154
            ......|.|..: |::.|.:.|.|..:|.||.:||:|.::|.:.:..........|..||:...|
Human   118 PGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHD 182

  Fly   155 GEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQ 219
            .:::.|......||.:|||.|..|.|..|.                    .:.:||.|..:||..
Human   183 KDLREIQHHLKKLEGRRLDFDYKKKRQGKI--------------------PDEELRQALEKFDES 227

  Fly   220 AEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQ----LQRELANLGG-------PT 273
            .||.:..:..:.......:..|.|.:|.|:.|:||...:::|    |:..:.....       |.
Human   228 KEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPK 292

  Fly   274 PYIPLDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPNQPMHVSTDQMQRARVLCSYDAKD 338
            |.:.|:.....:::.|         .|.:|:.....:|.:.:||.         .|.|..::.::
Human   293 PRMSLEFPTGDSTQPN---------GGLSHTGTPKPSGVQMDQPC---------CRALYDFEPEN 339

  Fly   339 HTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEML 382
            ..||.....::|.:|  :.::|::..|......|..|..:||:|
Human   340 EGELGFKEGDIITLT--NQIDENWYEGMLHGHSGFFPINYVEIL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 62/244 (25%)
SH3_Endophilin_B 327..378 CDD:212736 10/50 (20%)
SH3GL2XP_011516307.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.