DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and EndoA

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster


Alignment Length:385 Identity:90/385 - (23%)
Similarity:165/385 - (42%) Gaps:57/385 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFIFEKI 85
            |::..|...||:|..|.|:.|:.|..:..:.|||....|::...|:..|.|||..|.:....:.|
  Fly    10 INKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGI 74

  Fly    86 EKSKPKRLSNLEH-----LALDMIEAGGDFGQD-LPYGQALIKVGQAEQKLGQCEHDFIATSGIC 144
            .|...:..||...     ||..|:..|...|:| ..:.|||::.|:|.:::...::.........
  Fly    75 SKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQN 139

  Fly   145 FTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDL 209
            |.:||......::|.:...|..|:.:|||.| ||.|         :|:||.            ::
  Fly   140 FLEPLHHMQTKDLKEVMHHRKKLQGRRLDFD-CKRR---------RQAKDD------------EI 182

  Fly   210 RVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL------AN 268
            |.|:.:|....::.::.:..:..:...|:..|..|.:....::.||.||:..||..|      |.
  Fly   183 RGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAE 247

  Fly   269 LGGPTPYIP---LDVN--------EASASKSNISSGAA-ARGPGNNHSANMAATGHKPNQPMHVS 321
            ......::|   ||:|        ....:.|:|||.|: ...|..:.:.:||.|..:..||.   
  Fly   248 SRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPC--- 309

  Fly   322 TDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEM 381
                  .:.|..::.::..||....|::|  |..:.|::::..|......|..|:::|::
  Fly   310 ------CQALYDFEPENPGELAFKENDII--TLLNRVDDNWFEGAVNGRTGYFPQSYVQV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 61/245 (25%)
SH3_Endophilin_B 327..378 CDD:212736 10/50 (20%)
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 58/242 (24%)
SH3_Endophilin_A 312..361 CDD:212737 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2650
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.