DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and sh3gl2a

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_957410.1 Gene:sh3gl2a / 394091 ZFINID:ZDB-GENE-040121-3 Length:347 Species:Danio rerio


Alignment Length:393 Identity:93/393 - (23%)
Similarity:162/393 - (41%) Gaps:71/393 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNP 73
            :|..|.|:    ..:..|...||:|..|.|:.|:.|..:.::.|.|......|:..|...|.|||
Zfish     2 SVAGLKKQ----FHKATQRVSEKVGGAEGTKLDVDFTEMEKKVDTTSRAVLDILTKTTEYLQPNP 62

  Fly    74 QNRVEDFIFEKIEKSK-----PKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQC 133
            ..|.:..:...:.|.:     |........|...|.:||.:.|::..:|.|||.||:|.::||:.
Zfish    63 ATRAKMSMMSSMSKIRGGDKGPGYTQTETTLGEAMQKAGRELGEESCFGVALIDVGEAMRELGEV 127

  Fly   134 EHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISP 198
            :..........|..||:...|.::|.|......||.:|||.|..|.|..|.              
Zfish   128 KDALDMEVKQNFIDPLQNIHDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKV-------------- 178

  Fly   199 EAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQ 263
                  .|.:::.|..:||...||.:..:..:..:....:..|.|.:|.||.|::|..::::||.
Zfish   179 ------TEDEIKQALEKFDDSKEIAEQSMFNLLENDIEQVSQLSALVQAQVNYHRQAAEILQQLS 237

  Fly   264 REL------ANLGGPTPYIP-----LDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPNQ- 316
            .::      |:......|:|     ||.:|                   ||:.::..:|  |:: 
Zfish   238 SKIEDRIREASCKPKREYVPKPRTSLDFSE-------------------NHNGSIGHSG--PSRS 281

  Fly   317 --PMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFV 379
              ||    || ...|.|..:|.::..||.....::|.:|  |.:::::..|......|..|..:|
Zfish   282 PAPM----DQ-PCCRALYDFDPENEGELGFKEGDIITLT--SKIDDNWYEGMVNGQSGFFPVNYV 339

  Fly   380 EML 382
            ::|
Zfish   340 DIL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 63/244 (26%)
SH3_Endophilin_B 327..378 CDD:212736 11/50 (22%)
sh3gl2aNP_957410.1 BAR_Endophilin_A1 25..247 CDD:153297 59/241 (24%)
SH3_Endophilin_A 288..342 CDD:212737 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.