DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoB and SH3RF3

DIOPT Version :9

Sequence 1:NP_611410.1 Gene:EndoB / 37218 FlyBaseID:FBgn0034433 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001092759.1 Gene:SH3RF3 / 344558 HGNCID:24699 Length:882 Species:Homo sapiens


Alignment Length:240 Identity:58/240 - (24%)
Similarity:90/240 - (37%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDG---ISPEAVLEQAERDLRVAQA 214
            |:||..  |...|:|.|.......||...||:..   ::.|.|   :...|..::..|.......
Human   685 LNGEAG--GGPIGVLSTSSPTNTGCKLDEKKSEK---KEKKSGLLKLLAGASTKKKSRSPPSVSP 744

  Fly   215 EFDRQAEITKLLLDGIS---TSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYI 276
            ..|.|..:..||...:.   :|.:.|.|.....|::::    |....||.|.|:..:        
Human   745 THDPQVAVDALLQGAVGPEVSSLSIHGRAGSCPIESEM----QGAMGMEPLHRKAGS-------- 797

  Fly   277 PLDVNEASASKSNISSGAAARGPGNNHSANMAATGHKPN-QPMHVSTDQMQRARVLCSYDAKDHT 340
             ||:|..|              |......:|||...:|. .|       .:|.||:.||..:...
Human   798 -LDLNFTS--------------PSRQAPLSMAAIRPEPKLLP-------RERYRVVVSYPPQSEA 840

  Fly   341 ELNLSANEVIFVTECSPVNEDYMYGKQGLLK-----GLVPRAFVE 380
            |:.|...:::||.:   ..||..|  :|.|:     ||.|.:|||
Human   841 EIELKEGDIVFVHK---KREDGWY--KGTLQRNGRTGLFPGSFVE 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoBNP_611410.1 BAR_Endophilin_B 26..266 CDD:153278 28/118 (24%)
SH3_Endophilin_B 327..378 CDD:212736 17/55 (31%)
SH3RF3NP_001092759.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..42
RING 56..98 CDD:238093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..159
SH3_SH3RF3_1 197..250 CDD:212861
SH3_SH3RF3_2 260..314 CDD:212864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..399
Interaction with RAC1. /evidence=ECO:0000269|PubMed:20696164 369..439
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..458
SH3_SH3RF3_3 467..523 CDD:212858
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..747 11/56 (20%)
SH3_SH3RF_C 827..881 CDD:212719 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.